DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Abhd11

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_660250.1 Gene:Abhd11 / 68758 MGIID:1916008 Length:307 Species:Mus musculus


Alignment Length:314 Identity:67/314 - (21%)
Similarity:112/314 - (35%) Gaps:98/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NTESKEVPL--------------VLLHGLGAGIALWVMNLDAFAK------GRPVYAMDILGFGR 151
            |.:.:.:||              |.||||...    ..|.::.||      ||.|..:|....|.
Mouse    39 NADLRPLPLSYNLLDGDATLPAIVFLHGLFGS----KTNFNSLAKAMVQRTGRRVLTVDARNHGD 99

  Fly   152 SSR-PLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADP 215
            |.. |..:.:|:..:.|.:..      ::.:...:|:||||||..|...||..|:.|:.|::.| 
Mouse   100 SPHSPDASYEAMSQDLQGLLP------QLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVD- 157

  Fly   216 WGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEE- 279
                ..|..:|.|..|..::.|:..|..|        ...|..|     .|....::..|.::| 
Mouse   158 ----ISPVGTTPGSHIGAFIAAMKAVEIP--------EKVPHSQ-----ARKLADKQLSSVVKEA 205

  Fly   280 ---------------------DINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDV 323
                                 :::.|.|::.:               :.:|...:.|.       
Mouse   206 GIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDK---------------IMTFPQQREPY------- 248

  Fly   324 RSDIPITFIYGSRS-WIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVF 376
              ..|..|:.|..| ::..|...:|:  |......|:.|..|||.|::|||..|
Mouse   249 --SGPTLFLLGGNSTYVQPSHHSEIR--RLFPQAQIQTVPNAGHWVHSDKPQDF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 66/307 (21%)
Abhydrolase_5 114..>226 CDD:289465 34/132 (26%)
Abhd11NP_660250.1 Abhydrolase_5 60..196 CDD:289465 41/163 (25%)
PRK10673 61..307 CDD:182637 64/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.