DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and BPHL

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_004323.2 Gene:BPHL / 670 HGNCID:1094 Length:291 Species:Homo sapiens


Alignment Length:350 Identity:72/350 - (20%)
Similarity:124/350 - (35%) Gaps:110/350 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMN--------TESKEVPLVLLHG-LGAG 124
            ||.:...:...:.:|..|.....|.:|..|    .:::|        |...:..::||.| ||:|
Human    13 LRLLLSALKPGIHVPRAGPAAAFGTSVTSA----KVAVNGVQLHYQQTGEGDHAVLLLPGMLGSG 73

  Fly   125 IA-----LWVMNLDAFAKGRPVYAMDILGFGRSSRP-------LFAKDALVCEKQFVKSVEEWRR 177
            ..     |..:|...|.    |.|.|..|:|.|..|       .|.:||        |...:..:
Human    74 ETDFGPQLKNLNKKLFT----VVAWDPRGYGHSRPPDRDFPADFFERDA--------KDAVDLMK 126

  Fly   178 EMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVL 242
            .:....:.|||.|.||..|...|..:|..:..:::   ||.....:|..:  .|...:|.:::  
Human   127 ALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVI---WGANAYVTDEDS--MIYEGIRDVSK-- 184

  Fly   243 TPLNPLWALRAAGP----FG---------QWVVQKTRPDIMRKFQSTIEEDI--NLLPQYIHQCN 292
                  |:.|...|    :|         :||      |.:|:|:...:.:|  :|||:.  ||.
Human   185 ------WSERTRKPLEALYGYDYFARTCEKWV------DGIRQFKHLPDGNICRHLLPRV--QCP 235

  Fly   293 AQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVD 357
            |....||             |.|::.|.   .:|.....:.|||                     
Human   236 ALIVHGE-------------KDPLVPRF---HADFIHKHVKGSR--------------------- 263

  Fly   358 IKIVTGAGHHVYADKPDVFNRYVNE 382
            :.::....|:::....|.||:...:
Human   264 LHLMPEGKHNLHLRFADEFNKLAED 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 63/295 (21%)
Abhydrolase_5 114..>226 CDD:289465 32/124 (26%)
BPHLNP_004323.2 MhpC 44..291 CDD:223669 65/314 (21%)
Abhydrolase 58..259 CDD:304388 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.