DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Ephx2

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_075225.1 Gene:Ephx2 / 65030 RGDID:620732 Length:554 Species:Rattus norvegicus


Alignment Length:244 Identity:54/244 - (22%)
Similarity:83/244 - (34%) Gaps:97/244 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DIGPAVGEADKIWTISMNTESKEVPL-------------------VLLH----GLGAGIAL---- 127
            |...|:.|.:|:    ..|:..|.||                   :.||    |.|..|.|    
  Rat   205 DTASALRELEKV----TGTQFPEAPLPVPCSPNDVSHGYVTVKPGIRLHFVEMGSGPAICLCHGF 265

  Fly   128 ------WVMNLDAFAK-GRPVYAMDILGFGRSSRPLFAKD---ALVCEKQFVKSVEEWRREMNIN 182
                  |...:.|.|: |..|.|:|:.|:|.||.|...::   .|:||:...     :..::.|.
  Rat   266 PESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCEEMVT-----FLNKLGIP 325

  Fly   183 DMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNP 247
            ..:.:||...|.:..:.||.||||                            |||:|.:.|||.|
  Rat   326 QAVFIGHDWAGVLVWNMALFHPER----------------------------VRAVASLNTPLMP 362

  Fly   248 LWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNP 296
                             ..|::      :..|.|..:|.:.:|...|.|
  Rat   363 -----------------PNPEV------SPMEVIRSIPVFNYQLYFQEP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 48/220 (22%)
Abhydrolase_5 114..>226 CDD:289465 33/148 (22%)
Ephx2NP_075225.1 Phosphatase 1..224 5/22 (23%)
HAD-SF-IA-v3 5..203 CDD:273662
Phosphate binding. /evidence=ECO:0000250|UniProtKB:P34913 123..124
HAD_like <142..205 CDD:304363 54/244 (22%)
Epoxide hydrolase 233..554 46/212 (22%)
Abhydrolase 239..>379 CDD:304388 43/195 (22%)
Abhydrolase_1 257..530 CDD:278959 42/188 (22%)
Microbody targeting signal. /evidence=ECO:0000255 552..554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.