DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Abhd8

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_071864.2 Gene:Abhd8 / 64296 MGIID:1918946 Length:439 Species:Mus musculus


Alignment Length:363 Identity:81/363 - (22%)
Similarity:127/363 - (34%) Gaps:108/363 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TISMNTESK---------EVPLVLLHGLGAGIALWVMNLDAFAK-GRPVYAMDILGFGRSSRPLF 157
            ||.::.|.:         :|.|..:||:|..:|:|...||.|.: |..|.|.|:.|.|.||.|..
Mouse   149 TIHIDCEQRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQV 213

  Fly   158 AKDALVCEKQFVKSVEEWR-------REMNINDMILLGHSMGGFIASSYALSHPERVKHLILADP 215
            |     ....|....|:.|       ::.|    :|:|||.|....:..|..:|:.|..:|:.:.
Mouse   214 A-----AAYTFYALAEDMRAIFTRYAKKRN----VLIGHSYGVSFCTFLAHEYPDLVHKVIMING 269

  Fly   216 WGFPE--KPS--DSTNGKTIPLWVRAIARVLTPLNP--LWALRAAGPFGQWVVQKTRPDIMRKFQ 274
            .| |.  :||  ...|..|.         ||..|:|  .|:...||...|...:|          
Mouse   270 GG-PTALEPSLCSIFNMPTC---------VLHCLSPCLAWSFLKAGFARQGAKEK---------- 314

  Fly   275 STIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWI 339
                       |.:.:.||.|.| ......||....|   |....:......:|:..::|...  
Mouse   315 -----------QLLKEGNAFNVS-SFVLRAMMSGQYW---PEGDEVYHAELTVPVLLVHGMHD-- 362

  Fly   340 DSSSGEKIKSQRGSNMVDI------KIVTGAGHHVYADKPDVFNRYVNETCDMYKVAGGKLITPL 398
                 :.:..:....|.:|      |::....|.|..:.|:..|..::|..              
Mouse   363 -----KFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETVNTLLHEFL-------------- 408

  Fly   399 QLIRESTESDEEREPSLSTAKTVEVQPE---VQPVPQP 433
                 ..|.:.|.||.|      |.:|:   :||.|.|
Mouse   409 -----LWEPEPEAEPKL------EPKPKPQLLQPEPAP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 65/287 (23%)
Abhydrolase_5 114..>226 CDD:289465 36/123 (29%)
Abhd8NP_071864.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..148
MhpC 149..408 CDD:223669 70/309 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..439 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.