DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and LOC570571

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_021330474.1 Gene:LOC570571 / 570571 -ID:- Length:355 Species:Danio rerio


Alignment Length:280 Identity:65/280 - (23%)
Similarity:118/280 - (42%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PLVL-LHGLGAGIA--LWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEW 175
            ||:| |||......  .|...|..|:......|:|:.|.|.|..|:..:|.|:  :..:..:.:.
Zfish    98 PLMLFLHGFPENCCRYSWRHQLLEFSGDFHTVALDLRGCGASDAPVRLEDYLL--EALLYDIRDT 160

  Fly   176 RREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTI--PLWVRAI 238
            ..::.....||:||..||.:|..:||..|:.|:.||:.:    ...|: |..||.:  |:.:..:
Zfish   161 VDQLGHTSCILVGHDWGGMLAWHFALERPDMVQLLIVMN----APHPA-SWLGKKLFRPVIISLL 220

  Fly   239 --ARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESA 301
              ..||..:..|:..:..|     :..::|    |..:|.:|..:..|.|         |.|.:|
Zfish   221 FFNIVLHLVRSLFCGKNVG-----IRNRSR----RLTESQLEGYLYPLSQ---------PGGLTA 267

  Fly   302 ----FHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRS--WIDSSSGEKIKSQRGSNMVDIKI 360
                |.:::.:       .:::.:||.  :|...|:|...  .::..||......||.  |.|..
Zfish   268 PLNYFRSLLSN-------TLYKHQDVA--VPCMLIWGEADNILVEGMSGGTRPYVRGP--VTIHT 321

  Fly   361 VTGAGHHVYADKPDVFNRYV 380
            :....|.|..|:|::.|:.:
Zfish   322 IPECSHWVQQDQPEIVNKLI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 65/280 (23%)
Abhydrolase_5 114..>226 CDD:289465 31/114 (27%)
LOC570571XP_021330474.1 MhpC 82..341 CDD:223669 65/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.