DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and ephx2

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001008642.1 Gene:ephx2 / 494099 ZFINID:ZDB-GENE-041212-70 Length:557 Species:Danio rerio


Alignment Length:214 Identity:50/214 - (23%)
Similarity:81/214 - (37%) Gaps:73/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFA-KGRPVYAMDILGFGR 151
            :|:|.|.|    ||..:.|....   |::|.||.......|...:.|.| .|..|.|.|:.|:|.
Zfish   237 YVNIKPGV----KIHYVEMGDGP---PVLLCHGFPESWFSWRYQIPALADAGFRVLAPDMKGYGG 294

  Fly   152 SSRPLFAKDALVCEKQFVKSVEEWRREMNINDMI------------LLGHSMGGFIASSYALSHP 204
            |:.|              ..:||:.:|..:.|::            |:||..||.:..:.|..||
Zfish   295 STAP--------------PDIEEYSQEQIMLDLVTFLDKMAIAQVTLVGHDWGGVLVWNMAQFHP 345

  Fly   205 ERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPL-------NPLWALRAAGPFGQWVV 262
            ||                            |||:|.:.|||       ||:..|.|. |...:.:
Zfish   346 ER----------------------------VRAVASLNTPLFPVDPNTNPMEKLMAI-PIFDYQI 381

  Fly   263 QKTRPDIMRKFQSTIEEDI 281
            ...:|.:.   ::.:|:::
Zfish   382 YFQKPGVA---EAELEKNL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 43/188 (23%)
Abhydrolase_5 114..>226 CDD:289465 29/124 (23%)
ephx2NP_001008642.1 HAD-1A3-hyp 3..217 CDD:274054
HAD_like <155..203 CDD:304363
Abhydrolase 237..>358 CDD:304388 41/169 (24%)
Abhydrolase_1 255..531 CDD:278959 43/192 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.