DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and CG5704

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001286912.1 Gene:CG5704 / 48613 FlyBaseID:FBgn0026570 Length:335 Species:Drosophila melanogaster


Alignment Length:359 Identity:76/359 - (21%)
Similarity:121/359 - (33%) Gaps:124/359 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFAKGRP---- 140
            ||:|     |..|...|.    |..:.|    |.|::.:||       |:.||..|.:..|    
  Fly    12 VKIP-----VPWGHISGR----WYGNRN----ERPILAIHG-------WLDNLGTFDRLIPLLPD 56

  Fly   141 ---VYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALS 202
               |..:|:.|.||||.  ..........::|.::....:|...:.:.|:|||:||.::..||..
  Fly    57 YLGVLCIDLPGHGRSSH--LPPGMYYSVYEYVFTIPLVMKEYGWSKVSLIGHSLGGVLSFIYASL 119

  Fly   203 HPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRP 267
            .|..|..::..|                          :|.|      ||....:....::|...
  Fly   120 APHTVDMIVSLD--------------------------ILLP------LRNDIDYMDLSIEKQLV 152

  Fly   268 DIMR-KFQSTIEEDINLLPQYIHQCNAQNPSGE----SAFHTMMQSFGWAKHPMIHR-------- 319
            ::.| |..:.||.     |.|.|     |..|:    .:|:::....  ||| ::||        
  Fly   153 NVERQKLGNYIEP-----PSYTH-----NQLGKVLAAGSFNSVSPEL--AKH-LLHRQLAKSKLY 204

  Fly   320 ------IKDVR------SDI---------------PITFIYGSRS-WIDSSSGEKIKSQRGSN-M 355
                  .:|:|      .||               |...|.||.| ::...:.|.|......| .
  Fly   205 PERFYFTRDIRVKYYHYIDIDDSLGAEMARRIIKKPYLIIKGSLSPYLSVRNNEAISILAKDNPH 269

  Fly   356 VDIKIVTGAGHHVYADKPDVFNRYVNETCDMYKV 389
            .:...|....||::.        :..|.|..|.|
  Fly   270 FEFYEVENGTHHLHL--------HAAEECAGYIV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 63/316 (20%)
Abhydrolase_5 114..>226 CDD:289465 28/118 (24%)
CG5704NP_001286912.1 MhpC 32..301 CDD:223669 67/326 (21%)
Abhydrolase_5 33..>121 CDD:289465 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.