DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and MEST

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_002393.2 Gene:MEST / 4232 HGNCID:7028 Length:335 Species:Homo sapiens


Alignment Length:309 Identity:73/309 - (23%)
Similarity:109/309 - (35%) Gaps:99/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLG 122
            |.:|.||.         |..:|..|  |.|:.|....||             |.|: :|||||..
Human    40 LHSWKSSG---------KFFTYKGL--RIFYQDSVGVVG-------------SPEI-VVLLHGFP 79

  Fly   123 AGIALWVMNLDAFA-KGRPVYAMDILGFGRSSRP------LFAKDALVCEKQFVKSVEEWRREMN 180
            .....|....:... :...|.|:|.||||.|.:|      :|.:.::|  :..::.:....|.:|
Human    80 TSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSIFEQASIV--EALLRHLGLQNRRIN 142

  Fly   181 INDMILLGHSMGGFIASSYALSHPER------VKHLILADPWGFPEKPSD-------STNGKTIP 232
                 ||.|..|..:|......:.:.      :|.|.|::...|||....       ...|...|
Human   143 -----LLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSP 202

  Fly   233 LWVR-----AIARVLTPLNPLWALRAAGPFGQWVVQKTRP---DIMRKFQSTIEEDINL----LP 285
            :..|     ..:|.|||:        .||:       |||   ::...:......|.||    |.
Human   203 ILTRLMNFFVFSRGLTPV--------FGPY-------TRPSESELWDMWAGIRNNDGNLVIDSLL 252

  Fly   286 QYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYG 334
            |||:|               .:.|   :...:..:..|  .|||.||||
Human   253 QYINQ---------------RKKF---RRRWVGALASV--TIPIHFIYG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 59/253 (23%)
Abhydrolase_5 114..>226 CDD:289465 30/131 (23%)
MESTNP_002393.2 MhpC 47..321 CDD:223669 69/302 (23%)
RVIALD 98..103 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.