DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and CG7632

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster


Alignment Length:380 Identity:81/380 - (21%)
Similarity:137/380 - (36%) Gaps:113/380 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FLWKWLCNW--TSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEV-P 114
            ||.|.|.|.  :||.||....:..|....:.:|     |..|...|:    |     ...|.| |
  Fly     8 FLLKQLPNVRNSSSGPTKPFKILNKHFDEISIP-----VPWGHISGK----W-----YGPKHVRP 58

  Fly   115 LVLLHGLGAGIALWVMNLDAFAKGRPV-------YAMDILGFGRSS-----RPLFAKDALVCEKQ 167
            :|.:||       |..|...|....|:       .::|..|.|.||     ....:.|.::..::
  Fly    59 IVGMHG-------WQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLITRR 116

  Fly   168 FVKSVEEWRREMNINDMILLGHSM---GGFIASSYALSHPERVKHLILADPWGFPEKPS----DS 225
            .::       |.|.:.:.:|.|||   .||:.|:.   .|::|...:..|....|.:.:    ||
  Fly   117 LME-------EYNWDKISILAHSMSSINGFVFSAL---FPDKVDLFVGLDVLKPPVRSARGIVDS 171

  Fly   226 ---------------TNGKTIPL--WVRAIARVLTPLNPLWALRAAGPFGQWVVQKT-RPDIMRK 272
                           .:|...|.  |.:.:.|:....|...::.|.    ::::|:. :|     
  Fly   172 LTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDAC----KYLLQRNCKP----- 227

  Fly   273 FQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFI----- 332
              ||.|       .:.:..:..|....|.|:|:.|.   ....|..|||     .|..||     
  Fly   228 --STHE-------PHKYYFSRDNRLKSSLFYTLHQE---VPMEMARRIK-----CPHLFIKALQA 275

  Fly   333 --YGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPD----VFNRYVN 381
              |..:.:.|....|..|:.    :.:...|.|. |||:.::|:    :.|.::|
  Fly   276 PYYERKEYFDEVLAELQKNP----LFEYHEVEGT-HHVHLNEPEKVAPIINSFIN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 64/316 (20%)
Abhydrolase_5 114..>226 CDD:289465 29/145 (20%)
CG7632NP_649302.1 MhpC 57..326 CDD:223669 64/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.