DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and CG11309

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster


Alignment Length:421 Identity:85/421 - (20%)
Similarity:132/421 - (31%) Gaps:166/421 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TSSSPTMLRA---VEKKILSYVKLPYRGFFVDIGPAV--GEADKIWTISMNTESKEVPLVLLHGL 121
            |..:||..||   ..||           :|.:|...|  |.....|....|.:    |::.||| 
  Fly    27 TGEAPTRPRANIWCSKK-----------YFAEISITVPWGHISGKWYGPQNVQ----PILGLHG- 75

  Fly   122 GAGIALWVMNLDAFAKGRPV-------YAMDILGFGRSSR-P----LFAKDALVCEKQFVKSVEE 174
                  |..|...|.:..|:       .|:|:.|.|.||| |    ..:.|.|...:..:|.. :
  Fly    76 ------WQDNAGTFDRLMPLLSPDVAFLAIDLPGHGLSSRLPDGCYYNSVDNLYVIRLIMKQY-K 133

  Fly   175 WRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIA 239
            |.:      :.|:||||...|...:|...|::|..:|..|..    ||.                
  Fly   134 WEK------VSLVGHSMSSIICFVFAAVFPDKVDMIIGIDAL----KPH---------------- 172

  Fly   240 RVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDI---------NLLPQY-------- 287
                                   |:..|.::|..::.::|.:         |..|.|        
  Fly   173 -----------------------QRPYPSVIRTMETRLDEFLREDERNRSKNEPPSYTYDELIER 214

  Fly   288 -----IHQCNAQNPSGESAFHTMMQSFGWA-KHP--------------------------MIHRI 320
                 .|..|.     |...|.|.::.|.: |:|                          |.:||
  Fly   215 VYIGTFHSVNK-----EHCKHLMARNIGKSEKYPDKYFFCRDRRLKFYNYAIGSQELCVEMANRI 274

  Fly   321 KDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKI---------VTGAGHHVYADKPDVF 376
                 ..|..||..::    ||..|..|..  ..::|:.:         |.|: |||:.:.|:..
  Fly   275 -----TCPYLFIKAAQ----SSYFEDKKYY--DEVLDVLLKKPNFEYLEVNGS-HHVHMNDPEAI 327

  Fly   377 NRYVNETCDMYKVAGGKLITPLQLIRESTES 407
            ...||.....:..|..  ....|..:|:.||
  Fly   328 IAPVNNFIQRFGPAAA--AASRQKAKEAKES 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 66/337 (20%)
Abhydrolase_5 114..>226 CDD:289465 33/123 (27%)
CG11309NP_649301.1 MhpC 68..337 CDD:223669 67/346 (19%)
Abhydrolase_5 73..>158 CDD:289465 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.