DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and CG15820

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_647696.1 Gene:CG15820 / 38277 FlyBaseID:FBgn0035312 Length:308 Species:Drosophila melanogaster


Alignment Length:300 Identity:70/300 - (23%)
Similarity:110/300 - (36%) Gaps:70/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PLVLLHGLGAGIALWVMNLDAFAKGRP-------VYAMDILGFGRSSR-----PLFAKDALVCEK 166
            |::.:||       |:.||..|.:..|       |..:|:.|.|||||     |....|      
  Fly    31 PILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSSRLPPGVPYNVYD------ 82

  Fly   167 QFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFP---EKPSDSTNG 228
             :|..:....:|...:.:.|:|||:||.::..||...|..|..:|..|.. .|   |.||..|  
  Fly    83 -YVFIIPRVMKEFGWSKVSLMGHSLGGVMSFMYAAMAPSTVDMIISLDVL-LPRRIEDPSKLT-- 143

  Fly   229 KTIPLWVRAIARVLTPLNPLWALRAAGPFGQ---WVVQKTRPDIMRKFQSTIEEDINLLPQYIH- 289
            |.|..::....|           :|.|...:   :.:.|.|..:.|...:::.:  :|....:| 
  Fly   144 KDIEGYLLEERR-----------QADGTEHEPPSFTLSKLRETLARNSNNSVPQ--HLADHMLHR 195

  Fly   290 QCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDI-----------PITFIYGSRS-WIDSS 342
            |....|...|..|      |........:.|.|:.:.:           |...|.||.| ::...
  Fly   196 QVAKSNMYPEKVF------FSRDGRVKFYHIFDIENGLALEMARRIEKKPYLVIKGSLSPFVGPR 254

  Fly   343 SGE--KIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYV 380
            ..|  .|.|....|. :...|.|..|||:....:...||:
  Fly   255 CNETMSILSHDNPNF-EFYEVEGGKHHVHLHAAEECARYI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 70/299 (23%)
Abhydrolase_5 114..>226 CDD:289465 36/126 (29%)
CG15820NP_647696.1 MhpC 24..300 CDD:223669 70/299 (23%)
Abhydrolase_5 31..>119 CDD:289465 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.