DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and CG15879

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster


Alignment Length:314 Identity:62/314 - (19%)
Similarity:116/314 - (36%) Gaps:91/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EVPLVLLHGLGAGIALWVMNLDAFAKGRP-------VYAMDILGFGRSSRPLFAKDALVCEKQFV 169
            |.|::.:||       |:.||..|.:..|       |..:|:.|.|||:.  ...........:|
  Fly    28 ERPILAIHG-------WLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAH--IQPGMHYAVNDYV 83

  Fly   170 KSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLW 234
            ..:....:|...:.:.|:|||:||.|:..|....|:.|..:|..|                    
  Fly    84 LIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLD-------------------- 128

  Fly   235 VRAIARVLTPL--NPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEE-----------------D 280
                  :|.||  :|...::    :....:.|...:..|:.:..:.|                 |
  Fly   129 ------ILLPLSKDPKTVIK----YLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSD 183

  Fly   281 INLLPQYI-HQCNAQ-------------NPSGESAFHTMMQ---SFGWAKHPMIHRIKDVRSDIP 328
            .::.|::. |..:.|             :..|...:::.:|   .||.|   ::.||:    .||
  Fly   184 NSVTPEFAQHLLHRQVSKSQLYPDRFFFSRDGRVKYYSHLQMEPEFGEA---LVKRIR----RIP 241

  Fly   329 ITFIYGSRS-WIDSSSGEKIKSQRGSN-MVDIKIVTGAGHHVYADKPDVFNRYV 380
            ...|.||:| ::::.:.:.:...|.:| ..:...|.|..|||:....:...||:
  Fly   242 CLIIKGSKSDFVEARTEKAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 61/312 (20%)
Abhydrolase_5 114..>226 CDD:289465 28/118 (24%)
CG15879NP_647694.1 MhpC 29..302 CDD:223669 61/313 (19%)
Abhydrolase 47..>109 CDD:304388 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.