DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Ephx3

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001102458.1 Gene:Ephx3 / 366836 RGDID:1307206 Length:415 Species:Rattus norvegicus


Alignment Length:450 Identity:85/450 - (18%)
Similarity:149/450 - (33%) Gaps:130/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALASGGVVDP-TAASTSVTISNLPQPTVALGSESKSSMDLEDPRNNRFFLWKWLCNWTSSSPTML 69
            :::|.|.||| :...|......||.|.....|....|:.:.:.::...|:...|...:..|..:|
  Rat    12 SVSSAGPVDPDSTVETQNKGGGLPAPAPPAQSSDHGSVVVPERKDMPEFVVTALLAPSRLSLKLL 76

  Fly    70 RA-----------VEKKILSYVKL------PYRGFFVDIG-----------PAVGEADKIWTISM 106
            ||           |...:.|.|.|      |.||.   .|           |.:||...:...|.
  Rat    77 RALVMILVYLAALVAAFVYSCVALTNVLCHPRRGC---CGRQRSAPECLRDPTLGEHCFLTLRSS 138

  Fly   107 NTESKEV-------PLVL-LHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRP----LFAK 159
            ......|       ||:| |||.......|...|..|.....|.|:|:.|:..|..|    .:..
  Rat   139 GLRLHYVSAGRGNGPLMLFLHGFPENWFSWRYQLREFQSHFHVVAVDLRGYSPSDAPKDVDCYTV 203

  Fly   160 DALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILAD---------- 214
            |.|:.:      :::....:..:..||:.|..|..:|..:::..|..|..:|:..          
  Rat   204 DLLLTD------IKDIILGLGYSKCILVSHDWGAALAWDFSVYFPSLVDRMIVVSGPPMSVFQEY 262

  Fly   215 -------------------PWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQW 260
                               || .|||                    |..|:....|::.....:.
  Rat   263 STRHIGQLFRSNYIFLFQLPW-LPEK--------------------LLSLSDFQILKSIFTHHKK 306

  Fly   261 VVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESA----FHTMMQSFGWAKHPMIHRIK 321
            .:.:..|..:..|         |.| :.|      |.|.|.    :..:.::|     |:  ..|
  Rat   307 GIPRLSPCELEAF---------LYP-FSH------PGGLSGPINYYRNVFRNF-----PL--EPK 348

  Fly   322 DVRSDIPITFIYGSRSW-IDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYV 380
            ::..  |...::|.:.: :.....|.|:|......::..|:.|:||.:....|:..::|:
  Rat   349 ELSK--PTLLLWGEKDFSLQQGLVEAIESHFVPGRLESHILPGSGHWIPQSHPEEMHQYM 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 55/305 (18%)
Abhydrolase_5 114..>226 CDD:289465 30/145 (21%)
Ephx3NP_001102458.1 MhpC 133..406 CDD:223669 56/324 (17%)
Abhydrolase 140..413 CDD:304388 56/318 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.