DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Bphl

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001032283.1 Gene:Bphl / 361239 RGDID:1307572 Length:291 Species:Rattus norvegicus


Alignment Length:338 Identity:74/338 - (21%)
Similarity:121/338 - (35%) Gaps:86/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LRAVEKKILSYVKLPYRGFFVDIGPAVGEA----DKIWTISMNTESKEVPLVLLHG-LGAGIALW 128
            ||.:...:.|.:.:|........|.||..|    :.|..........|..::||.| ||:|...:
  Rat    13 LRLLLSPLKSRICVPQAEHAATFGTAVTSAKAAVNGIHLHYQRVGEGEHAVLLLPGMLGSGKTDF 77

  Fly   129 VMNLDAFAKGR-PVYAMDILGFGRSSRP-------LFAKDALVCEKQFVKSVEEWRREMNINDMI 185
            ...|.:..|.| .:.|.|..|:|.|..|       .|.:||        |...:..:.:....:.
  Rat    78 APQLQSLNKKRFTLVAWDPRGYGESRPPDRDFPRDFFERDA--------KDAVDLMKALQFKQVS 134

  Fly   186 LLGHSMGGFIASSYALSHPERVKHLILADPWG----FPEKPSDSTNG-KTIPLWVRAIARVLTPL 245
            |||.|.||..|...|..:|..::.:::   ||    ..|:.|....| :.:..|.....:     
  Rat   135 LLGWSDGGITALIAAAKYPSYIRKMVI---WGANAYVTEEDSRIYQGIRDVSKWSEKARK----- 191

  Fly   246 NPLWALRAAGPFG----QWVVQKTRPDIMRKFQSTIEEDI--NLLPQYIHQCNAQNPSGESAFHT 304
             ||.||.....|.    :||      |.:.:|:...:.:|  :|||  :.||......||     
  Rat   192 -PLEALYGHDYFAKTCEKWV------DGINQFKHLPDGNICRHLLP--LIQCPTLIVHGE----- 242

  Fly   305 MMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVY 369
                    |.|::.|.   .:|..:..:.|||                     :.::....|:::
  Rat   243 --------KDPLVPRF---HADFLLEHVKGSR---------------------LHLMPEGKHNLH 275

  Fly   370 ADKPDVFNRYVNE 382
            ....|.|||.|.:
  Rat   276 LRFADEFNRLVED 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 64/287 (22%)
Abhydrolase_5 114..>226 CDD:289465 32/124 (26%)
BphlNP_001032283.1 MhpC 44..291 CDD:223669 66/307 (21%)
Abhydrolase 58..259 CDD:304388 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.