DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and B0464.9

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_499084.1 Gene:B0464.9 / 181999 WormBaseID:WBGene00007188 Length:364 Species:Caenorhabditis elegans


Alignment Length:378 Identity:77/378 - (20%)
Similarity:129/378 - (34%) Gaps:126/378 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPL-VLLHGLGAGIALWV 129
            |:...:.:|:.:|  :||:..||.:...|..:.|   ..::..:..|.|: .||||.|.....|.
 Worm    42 PSTSTSGKKREMS--ELPWSDFFDEKKDANIDGD---VFNVYIKGNEGPIFYLLHGGGYSGLTWA 101

  Fly   130 MNLDAFAK------GRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREM-----NI-- 181
                .|||      ...|.|.|:.|.|.:.          |..:...|.|...:::     ||  
 Worm   102 ----CFAKELATLISCRVVAPDLRGHGDTK----------CSDEHDLSKETQIKDIGAIFKNIFG 152

  Fly   182 ---NDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLT 243
               :.:.::||||||.:|.           |.:               |.|.|...|.|:..:  
 Worm   153 EDDSPVCIVGHSMGGALAI-----------HTL---------------NAKMISSKVAALIVI-- 189

  Fly   244 PLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQS 308
                                    |::   :.:..|.:..:..::|...:..||.|.|.|..:.|
 Worm   190 ------------------------DVV---EGSAMEALGGMVHFLHSRPSSFPSIEKAIHWCLSS 227

  Fly   309 FGWAKHP------MIHRIKDV-------RSDIPITFIYGSRSWIDSSSGE-------KIKSQRGS 353
             |.|::|      |..:|::|       |.|:..|..|. :.|.:..|.|       |:....|.
 Worm   228 -GTARNPTAARVSMPSQIREVSEHEYTWRIDLTTTEQYW-KGWFEGLSKEFLGCSVPKMLVLAGV 290

  Fly   354 NMVDIKIVTG-------------AGHHVYADKPDVFNRYVNETCDMYKVAGGK 393
            :.:|..:..|             .||.|..|.|......|......:::|..|
 Worm   291 DRLDRDLTIGQMQGKFQTCVLPKVGHCVQEDSPQNLADEVGRFACRHRIAQPK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 65/317 (21%)
Abhydrolase_5 114..>226 CDD:289465 28/128 (22%)
B0464.9NP_499084.1 Fe-S_biosyn 49..>89 CDD:294282 10/44 (23%)
MhpC 68..337 CDD:223669 68/342 (20%)
Abhydrolase_5 89..>190 CDD:289465 32/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.