DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and F35H12.5

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001024631.1 Gene:F35H12.5 / 180442 WormBaseID:WBGene00018077 Length:357 Species:Caenorhabditis elegans


Alignment Length:269 Identity:53/269 - (19%)
Similarity:94/269 - (34%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 FVKSVEEWRREMNINDMILLGHSMGG--FIASSYALSHPER---VKHLILADPWGFPEKPSDSTN 227
            ::||:.|.....|:|.:|::|||.||  .:..:..||:.|.   |..:::..|...|.|      
 Worm   128 YMKSLMETLELKNVNRLIIMGHSRGGENALQLTSMLSNDENWPLVGAVMINSPGFAPHK------ 186

  Fly   228 GKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCN 292
                     .|::.:..:|.:.:|                  :::...||...::.:..|.:   
 Worm   187 ---------GISKRMGTINFIISL------------------IKRHNKTINSILHPILHYFY--- 221

  Fly   293 AQNPSGESAFH--------TMMQSFGWAKHPMIHRIKDVRS--DIPITFIYGSRSW-IDSSSGEK 346
             .|..|....|        ..||:|.:.:..:  .|.|:|:  .|...:.|||:.: ||....|:
 Worm   222 -NNLIGLRVSHGKVAAAAILPMQTFAFDEQKL--SIDDLRAKPGIRAFYGYGSKDFLIDEHQSEE 283

  Fly   347 ----------------------IKSQRGSNMVDIKIVTG----AGHHVYADKPDVFNRYVNETCD 385
                                  ||..|.|.....:.||.    .||.:....|:.....|:...|
 Worm   284 VAMYFSEEDHYVISNKQDAEKAIKEARKSFTTGKQFVTANFKEEGHFLQKTYPEFIVEVVDSIFD 348

  Fly   386 MYKVAGGKL 394
            ..|....|:
 Worm   349 ADKEVDTKI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 50/255 (20%)
Abhydrolase_5 114..>226 CDD:289465 18/62 (29%)
F35H12.5NP_001024631.1 DUF1057 37..348 CDD:115027 50/258 (19%)
MhpC 53..349 CDD:223669 50/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.