DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Y73C8B.2

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001379784.1 Gene:Y73C8B.2 / 178757 WormBaseID:WBGene00022259 Length:308 Species:Caenorhabditis elegans


Alignment Length:222 Identity:39/222 - (17%)
Similarity:69/222 - (31%) Gaps:76/222 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 TRPDIMR---KFQSTIEEDINLLPQYIHQCNAQNPSGE-SAFHTMMQSFGWAKHPMIHRIKDVRS 325
            :.|.:::   |||:..|:.:.|...|.....:.:|.|. .|||....|     |.....|:....
 Worm    10 SEPKLLKKLVKFQAENEQFVELEAVYEDSITSGSPFGTVVAFHGSPGS-----HNDFKYIRSKLD 69

  Fly   326 DIPITFI---YGSRSWIDSSSGEKIKSQRGSNM---------VDIKIV----------------- 361
            |:.|.||   |...|......|::..:....|.         :|.||:                 
 Worm    70 DLNIRFIGVNYPGFSNTPEYEGQQHANPERQNFSNALLDELKIDGKIIYMGHSRGCENALQTAVG 134

  Fly   362 -----------TGAGHH--------------VYADKPDVFNRYVNETCDMYKVAGGKLITPLQLI 401
                       ||..||              :|...|.....  :....:||..|.|:       
 Worm   135 REAHGLVLINPTGFRHHQGIRPFYRLEYLDWMYGLLPSFLGN--SMILGIYKAIGFKV------- 190

  Fly   402 RESTESDEEREPSLSTAKTVEVQPEVQ 428
                :|.||...::.:...:.::.:::
 Worm   191 ----KSGEEAMCAMRSVMRMSLEDQIE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 32/174 (18%)
Abhydrolase_5 114..>226 CDD:289465
Y73C8B.2NP_001379784.1 DUF1057 11..307 CDD:115027 39/221 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.