DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and ceeh-1

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_497268.1 Gene:ceeh-1 / 175239 WormBaseID:WBGene00019329 Length:404 Species:Caenorhabditis elegans


Alignment Length:368 Identity:70/368 - (19%)
Similarity:128/368 - (34%) Gaps:119/368 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVL-LHGLGAGIALWV 129
            |.:|...:.:   |:||                .|:....:.|.|.:.||:| :||.......|.
 Worm   111 PNVLEGWDSR---YIKL----------------KKVRLHYVQTGSDDKPLMLFIHGYPEFWYSWR 156

  Fly   130 MNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGF 194
            ..|..||......|:|..|:..|.:|....:..:.|  ....:.:....:..:..|::.|..||.
 Worm   157 FQLKEFADKYRCVAIDQRGYNLSDKPKHVDNYSIDE--LTGDIRDVIEGLGYDKAIVVAHDWGGL 219

  Fly   195 IASSYALSHPERVKHLILAD---PWGF-------------------------PEKPSDSTNGKTI 231
            :|..:|..:||.|..||..:   |..|                         ||....:.:.|.:
 Worm   220 VAWQFAEQYPEMVDKLICCNIPRPGSFRKRIYTSWSQFRKSWYMFFYQNEKIPEMLCSADDMKML 284

  Fly   232 PLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNP 296
            .|..||              :..|      :|..:        :..:||:.              
 Worm   285 ELCFRA--------------KEIG------IQNNK--------NFTDEDLE-------------- 307

  Fly   297 SGESAFHTMMQSFGWAKHPM-----IHRIKDVRSDI----PITFIYGS-------RSWIDSSSGE 345
            :.:.:|.....||   |:|:     |...|..::|:    |...|:|:       .:.:||.:..
 Worm   308 AWKYSFSMNGASF---KYPINYYRNIFNAKKQQADLVLEMPTLIIWGTADGALDIEAAVDSLNTL 369

  Fly   346 KIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCDMYK 388
            |    :|:    :|.:.||.|.|..|:|::.|.::.:..:.|:
 Worm   370 K----QGT----MKKIEGASHWVQQDEPEMVNEHIKKFLNKYQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 61/312 (20%)
Abhydrolase_5 114..>226 CDD:289465 30/140 (21%)
ceeh-1NP_497268.1 MhpC 119..400 CDD:223669 67/354 (19%)
Abhydrolase 128..>257 CDD:304388 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.