DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and LOC100329433

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_002665655.2 Gene:LOC100329433 / 100329433 -ID:- Length:281 Species:Danio rerio


Alignment Length:275 Identity:124/275 - (45%)
Similarity:180/275 - (65%) Gaps:5/275 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LVLLHGLGAGIALWVMNLDAFAK-GRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRRE 178
            ||||||.||.:.|||:||.|.|: ||||.|:|:|||||||||:|:.|....|:|.|:::|.||.:
Zfish     4 LVLLHGFGAAVGLWVLNLQALAQAGRPVLALDLLGFGRSSRPVFSTDPQQAEQQQVEALEHWRSQ 68

  Fly   179 MNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLT 243
            ..:..||||||.:|.:|:::|||::|:|||||||.:||||..:|  |...:.:|.|::.....:.
Zfish    69 QRVESMILLGHHLGAYISAAYALAYPQRVKHLILVEPWGFSARP--SAPERWVPFWIKVFGAAMN 131

  Fly   244 PLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQS 308
            |.|||..||.|||.|..::|..|.|..:|:.:...:  |.:|.||:..|.|..|||..|..|...
Zfish   132 PFNPLALLRLAGPLGPLLLQLLRSDFKQKYSALFSD--NTVPDYIYHINTQTASGEVGFKNMTVP 194

  Fly   309 FGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKP 373
            :||.:||::.|:..:...:||:|||||||.||..||..::..|..:..::.::.||||:|:||:|
Zfish   195 YGWPQHPLLERMDKISPSLPISFIYGSRSCIDGQSGRILQEMRPGSHTEVIVIQGAGHYVFADQP 259

  Fly   374 DVFNRYVNETCDMYK 388
            :.|||.|.|.|:..|
Zfish   260 EDFNRAVLEICNSVK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 121/267 (45%)
Abhydrolase_5 114..>226 CDD:289465 62/111 (56%)
LOC100329433XP_002665655.2 MhpC 1..268 CDD:223669 121/267 (45%)
Abhydrolase_5 3..>106 CDD:289465 57/101 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1555935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.