DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and serhl2

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001096280.2 Gene:serhl2 / 100124846 XenbaseID:XB-GENE-943365 Length:304 Species:Xenopus tropicalis


Alignment Length:297 Identity:67/297 - (22%)
Similarity:113/297 - (38%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PLVLLHGLGAGIALWVMNLDAFAKGRPV-------YAMDILGFGRSSRPLFAKDALVCEKQFVKS 171
            |::.|||       |:.|.:.|.:..|:       .|:|..|.|.||.  ..:........:|..
 Frog    29 PVLCLHG-------WLDNANTFDRLIPLLPNDHHFVALDFSGHGLSSH--MPEGVRYQHVDYVSD 84

  Fly   172 VEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWG-FPEKPSDSTNGKTIPLWV 235
            |.....::......::||||||.:...:|...|:.||:|||.|.:| ||      .|...|...:
 Frog    85 VHRVVTQLGWRQFSIMGHSMGGVVGGLFASVFPKLVKNLILLDSYGFFP------VNADMIQTHL 143

  Fly   236 RAIARVLTPLNPLWALRAAGPFGQW---------VVQKTRPDIMRKFQSTIE------EDI---- 281
            :.|....:.|..:.|.:...|.|..         :.|:|...::.:...|:|      .||    
 Frog   144 KKIISYYSRLEGVSAGKIYSPEGALQRLLEANVSLTQETAKLLLERGTKTVEGGVVFSRDIRVTV 208

  Fly   282 -NLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGE 345
             |.||....||.......::..|.:|.:.|.....|    :.|.:|:....:.|.|        |
 Frog   209 NNSLPLSTEQCVLMLSKIQADVHIIMANEGLTADMM----RGVYTDVGQALLKGFR--------E 261

  Fly   346 KIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNE 382
            .:|.:....:||      ..|.|:.::|:.....:|:
 Frog   262 SLKERCQVTVVD------GNHFVHLNEPEKVAGIIND 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 66/295 (22%)
Abhydrolase_5 114..>226 CDD:289465 33/119 (28%)
serhl2NP_001096280.2 MhpC 16..297 CDD:223669 67/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.