DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sax and CRK42

DIOPT Version :9

Sequence 1:NP_001246193.1 Gene:sax / 35731 FlyBaseID:FBgn0003317 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_198854.3 Gene:CRK42 / 834036 AraportID:AT5G40380 Length:651 Species:Arabidopsis thaliana


Alignment Length:458 Identity:106/458 - (23%)
Similarity:175/458 - (38%) Gaps:146/458 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QCWKSRTRDADGQVQESRGCSTSPDQLPMICSQNSLK-INGPSKRNTGKFVNVVCCA--GD---Y 159
            |||:|..::         .|        .:|.:.::| :.....|..|:.:|..|..  .|   |
plant   190 QCWESLGKE---------DC--------RVCLEKAVKEVKRCVSRREGRAMNTGCYLRYSDHKFY 237

  Fly   160 CNEGDFPELLPFDSNDVTVITADTSSISKMLVAVLGPFLVIALLGAVTIFFIRRSHRKRLAASRT 224
            ..:|.....:.|:...:..|...||:           |:::.||....|.         ...|:|
plant   238 NGDGHHKFHVLFNKGVIVAIVLTTSA-----------FVMLILLATYVIM---------TKVSKT 282

  Fly   225 KQDPEAY-LVN------------DELLRATSAGDSTLREYLQHSVTSGSGSGLPLLVQRTLAKQV 276
            ||:.... ||:            :.|.:||        :|..|.                     
plant   283 KQEKRNLGLVSRKFNNSKTKFKYETLEKAT--------DYFSHK--------------------- 318

  Fly   277 TLIECIGRGKYGEVWRGHW-HGESIAVK--IFFSRD-EESWKRETEIYSTILLRHENILGFIGSD 337
               :.:|:|..|.|:.|.. :|:::|||  :|.:|| .|.:..|..:.|.|  :|:|::..:|..
plant   319 ---KMLGQGGNGTVFLGILPNGKNVAVKRLVFNTRDWVEEFFNEVNLISGI--QHKNLVKLLGCS 378

  Fly   338 MTSRNSCTQLWLMTHYYPLGS----LFDHLNRNALSHNDMVWICLSIANGLVHLHTEIFGKQGKP 398
            :....|.    |:..|.|..|    |||......|:.:..:.|.|..|.||.:||      .|.|
plant   379 IEGPESL----LVYEYVPNKSLDQFLFDESQSKVLNWSQRLNIILGTAEGLAYLH------GGSP 433

  Fly   399 A-MAHRDLKSKNILVTSNGSCVIADFGLA----VTHSHVTGQLDLGNNPKVGTKRYMAPEVLDES 458
            . :.|||:|:.|:|:....:..|||||||    :..:|::..:       .||..|||||.:...
plant   434 VRIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDKTHLSTGI-------AGTLGYMAPEYVVRG 491

  Fly   459 IDLECFEALRRTDIYAFGLVLWEVCRRTISCGIAEEYKVP-----------FYD----VVPMDPS 508
                  :...:.|:|:||:::.|     |:||......||           .|.    |..:||.
plant   492 ------QLTEKADVYSFGVLVLE-----IACGTRINAFVPETGHLLQRVWNLYTLNRLVEALDPC 545

  Fly   509 FED 511
            .:|
plant   546 LKD 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saxNP_001246193.1 Activin_recp 77..168 CDD:279413 14/72 (19%)
TM_EGFR-like 182..218 CDD:213052 6/35 (17%)
TGF_beta_GS 247..274 CDD:285687 2/26 (8%)
STKc_ACVR1_ALK1 270..567 CDD:271044 73/270 (27%)
TyrKc 276..553 CDD:197581 73/264 (28%)
CRK42NP_198854.3 Stress-antifung 40..131 CDD:279926
Stress-antifung <174..232 CDD:279926 11/58 (19%)
Pkinase_Tyr 319..588 CDD:285015 73/260 (28%)
STKc_IRAK 321..590 CDD:270968 73/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.