DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sax and AT3G45410

DIOPT Version :9

Sequence 1:NP_001246193.1 Gene:sax / 35731 FlyBaseID:FBgn0003317 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_190127.1 Gene:AT3G45410 / 823679 AraportID:AT3G45410 Length:664 Species:Arabidopsis thaliana


Alignment Length:279 Identity:81/279 - (29%)
Similarity:122/279 - (43%) Gaps:71/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 EC-IGRGKYGEVWRGHW-HGESIAVKIFFSRDEESWKRE--TEIYSTILLRHENILGFIGSDMTS 340
            :| :|:|.:|||::|.. .|..|||| ..|.|.|...::  .|:.:...|:|.|::..:|   ..
plant   345 DCRVGKGGFGEVYKGTLPGGRHIAVK-RLSHDAEQGMKQFVAEVVTMGNLQHRNLVPLLG---YC 405

  Fly   341 RNSCTQLWLMTHYYPLGSLFDHL---NRNALSHNDMVWICLSIANGLVHLHTEIFGKQGKPAMAH 402
            |..| :|.|::.|.|.|||..:|   ...:.|....:.|...||:.|.:|||..     |..:.|
plant   406 RRKC-ELLLVSEYMPNGSLDQYLFHEGNPSPSWYQRISILKDIASALSYLHTGT-----KQVVLH 464

  Fly   403 RDLKSKNILVTSNGSCVIADFGLAVTHSHVTGQLDLGNNPKVGTKRYMAPEVLDESIDLECFEAL 467
            ||:|:.|:::.|..:..:.|||:|..|...|   :|.....|||..|||||::.....:      
plant   465 RDIKASNVMLDSEFNGRLGDFGMAKFHDRGT---NLSATAAVGTIGYMAPELITMGTSM------ 520

  Fly   468 RRTDIYAFGLVLWEVCRRTISCGIAEEYKVPFYDVVPMDPSFEDMRKVVCIDNYRPSIPNRWSSD 532
             :||:||||..|.||.     ||                      |:.|     .|.:|      
plant   521 -KTDVYAFGAFLLEVI-----CG----------------------RRPV-----EPELP------ 546

  Fly   533 SLMTGMSKLMK---ECWHQ 548
               .|...|:|   |||.:
plant   547 ---VGKQYLVKWVYECWKE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saxNP_001246193.1 Activin_recp 77..168 CDD:279413
TM_EGFR-like 182..218 CDD:213052
TGF_beta_GS 247..274 CDD:285687
STKc_ACVR1_ALK1 270..567 CDD:271044 81/279 (29%)
TyrKc 276..553 CDD:197581 81/279 (29%)
AT3G45410NP_190127.1 Lectin_legB 27..272 CDD:278564
STKc_IRAK 348..612 CDD:270968 80/276 (29%)
STYKc 349..610 CDD:214568 80/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.