DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop17l and Pih1d2

DIOPT Version :9

Sequence 1:NP_610324.2 Gene:Nop17l / 35730 FlyBaseID:FBgn0033224 Length:834 Species:Drosophila melanogaster
Sequence 2:XP_006510690.1 Gene:Pih1d2 / 72614 MGIID:1919864 Length:331 Species:Mus musculus


Alignment Length:342 Identity:84/342 - (24%)
Similarity:144/342 - (42%) Gaps:70/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FFDYVDEI--QDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTAL--DGELKCFINIASCE 102
            |::.:|::  .|||.   |.:.|.| |.:.|.:: .::|:|...|:|.:  ..|...|||:...|
Mouse    31 FWNMLDDLAENDPER---YRNFIQQ-ELKDGKQL-CVNPEPQLCIQTKILKPNEKVLFINLCQWE 90

  Fly   103 EIQRPKNEVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVFHPDALHLAMRNKQFRQ 167
            .|..|::  ||.|          :|::.....|..:|.:.: .:.||.::|..|..|.:::..:.
Mouse    91 RIPAPQS--ATRP----------VPVSVGRPEDSAEASDAY-TIIDVAYNPGVLQAAEKDQGIKD 142

  Fly   168 CLIDTALDAIE----------------------REYKVSLDRANLKFPKLDYKGIPRPTVIRKMA 210
            .||..|:..||                      :..|.||......||  |.|.:.|..  ..:|
Mouse   143 QLIRMAMLCIEERLQFTLAHSYHLTSFRLKGSIQRMKESLMGIKTDFP--DLKAMTRTE--NTLA 203

  Fly   211 DNPTAEEQEPHPLAHMFPTKPPAPGKQEPRVLPMKTKPSPVP-EFTVPRYTIKHSHDVDLSEYTD 274
            ...::...||:.|..:..||..|..|  .|.|..:...|.:. |...|.|.:|...|.:      
Mouse   204 RIRSSTVSEPNHLPEVLLTKKQASAK--GRCLIEEISSSEIQVEVKKPAYELKVVKDRN------ 260

  Fly   275 ELDAKLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIYL-FSERQGAKYRLKLDLPFIVDDKAG 338
                    ..|..:.:::|||.::|.:.|:|.|:...|.: .||    .|||.|:||..::.:..
Mouse   261 --------EKPLKIELKVELPGIKSVSLCELSVSEVDILIEVSE----MYRLCLNLPESINTEMT 313

  Fly   339 RARFDTDMRRLSITLPV 355
            .|:|..:...|.||:|:
Mouse   314 TAKFVKNKSALIITMPL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop17lNP_610324.2 PIH1 49..355 CDD:285409 81/333 (24%)
Pih1d2XP_006510690.1 alpha-crystallin-Hsps_p23-like 41..184 CDD:381838 38/160 (24%)
PIH1_CS 244..329 CDD:375629 27/102 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.