DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop17l and PIH1D1

DIOPT Version :9

Sequence 1:NP_610324.2 Gene:Nop17l / 35730 FlyBaseID:FBgn0033224 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_060386.1 Gene:PIH1D1 / 55011 HGNCID:26075 Length:290 Species:Homo sapiens


Alignment Length:338 Identity:74/338 - (21%)
Similarity:127/338 - (37%) Gaps:78/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EAFGKE--EFRKLFFDYVDEIQDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTALDGELK 93
            ||.|.:  .|.:|......|:|..:..:   .|.||           |.|:|||.|||. ..|.|
Human    15 EAIGADSARFEELLLQASKELQQAQTTR---PESTQ-----------IQPQPGFCIKTN-SSEGK 64

  Fly    94 CFINIASCEEIQRPKN-------EVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVF 151
            .||||.....|..|.:       ::..:..:|.|     |||:......:.|||...|..:||..
Human    65 VFINICHSPSIPPPADVTEEELLQMLEEDQAGFR-----IPMSLGEPHAELDAKGQGCTAYDVAV 124

  Fly   152 HPDALHLAMRNKQF-RQCLIDTALDAIEREYKVSLDRANLKFPKLDYKGIPRPTVIRKMADNPTA 215
            :.| .:..|:|..| |:.:|..|.:.:|.:|.:.|:.        :::.:.....:..::.....
Human   125 NSD-FYRRMQNSDFLRELVITIAREGLEDKYNLQLNP--------EWRMMKNRPFMGSISQQNIR 180

  Fly   216 EEQEPHPLAHMFPTKPPAPGKQE--PRVLPMKTKPSPVPEFTVPRYTIKHSHDVDLSEYTDELDA 278
            .||.|. :..:.....||||:.|  |.      ||                            ..
Human   181 SEQRPR-IQELGDLYTPAPGRAESGPE------KP----------------------------HL 210

  Fly   279 KLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIYLFSERQGAKYRLKLDLPFIVDDKAGRARFD 343
            .|.:..|..|:.|::||.|.......|::....:.:...:|  .|.|...:|..::....:|.|.
Human   211 NLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQ--LYHLDAYIPLQINSHESKAAFH 273

  Fly   344 TDMRRLSITLPVV 356
            ...::|.:.:|::
Human   274 RKRKQLMVAMPLL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop17lNP_610324.2 PIH1 49..355 CDD:285409 67/315 (21%)
PIH1D1NP_060386.1 alpha-crystallin-Hsps_p23-like 30..284 CDD:294116 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4625
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.