DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop17l and CG4022

DIOPT Version :9

Sequence 1:NP_610324.2 Gene:Nop17l / 35730 FlyBaseID:FBgn0033224 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_001246696.1 Gene:CG4022 / 39082 FlyBaseID:FBgn0035986 Length:531 Species:Drosophila melanogaster


Alignment Length:522 Identity:91/522 - (17%)
Similarity:163/522 - (31%) Gaps:170/522 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PKPGFVIKTALDGELKCFINIASCEEIQRPKNEVATDP---SSGSR---GLSWSIPMAQTTSRDD 136
            |:|...|:|..:...:.|||:.|...|..|:.  .:||   ..|.|   |...|.|:        
  Fly   106 PQPHMCIRTTTEAGEELFINVLSWTRIVIPQE--PSDPIPLYGGMRVPPGSPRSPPI-------- 160

  Fly   137 FDAKNNHCKVFDVVFHPDALHLAMRNK---QFRQCLIDTALDAIE---------REYKVSLDR-- 187
                     ||.|:.:|:.|..:.|:.   :.|:.:::...|.:|         |...:..||  
  Fly   161 ---------VFAVMANPEVLKDSGRHSKDPEERRAMVELMCDFVEAMNPGVKLVRNAVILKDRDI 216

  Fly   188 -ANLKFPKLDYKGIPRPTVIRKMADNPTAEEQEPH----PLAHMFPTKPPA--PGKQEPRVLPMK 245
             ..||    |.....:....|:..:....:.|:.|    ....|||..|.|  .......|....
  Fly   217 SGELK----DVWNAVQAQRDREREEQMMQQRQQQHYQNITTQQMFPKSPDASRAASAGAAVNEAS 277

  Fly   246 TKPSPVPEFTVPRYTIKHSHDVDLSEYTDELDAKLHVTVPRSLVVEIELPLLRSTAECQLDVTSK 310
            :.|:.:.|..:......:.:.:.|:.:..:||.|:                              
  Fly   278 SPPAHLSEPLLVEQGNGNGNGITLAVFAQQLDNKV------------------------------ 312

  Fly   311 SIYLFSERQGAKYRLKLDLPFIVDDKAGRARFDTDMRRLSITLPVVRKSIQEQAQMHETLRHFSR 375
                 :..||.:..                                :..:.|.|.:.:|      
  Fly   313 -----ASEQGEQQE--------------------------------QSPVSEDACVDQT------ 334

  Fly   376 EDSGVELH------SNSESPVEEDPDGELSDSKA----------------DISETSSPSVAPAN- 417
             |:|..|:      .|....||.:|:.:::...|                ..:.|||||..|.. 
  Fly   335 -DAGSSLNGSTTVLDNQPVAVENEPEVKVAPPAATNGASTPTPSHATPTVTATATSSPSPTPTPV 398

  Fly   418 -SPFLKSSVHYQLPSKFD--CNVLDNVMAFVLHVPNVQPDSIEQLREQRSLH---------LKFA 470
             :|.:.::.....|:|.:  ...|.|...|.....|...|.....:|.:|..         .|..
  Fly   399 VAPVVTATPPPAAPAKKEKLGGFLPNGCIFPRFKNNKHKDKDNSHKEGKSKEKTLLNALKKSKEK 463

  Fly   471 TIGSGYYPTHYAFYVEL-SAEHEDSSIESAEAEA----------WDNNVVLKLCLNSQSETPASY 524
            .:.....||..|...:. :.::|.:.|.:.|.|.          .||::.:||.::..:.|.|:.
  Fly   464 KVAPSEQPTEKAAASDNGTTQYEKNCINNLECEVQKLDLNSGTNGDNSMFIKLKVSPANATAAAA 528

  Fly   525 LA 526
            .|
  Fly   529 AA 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop17lNP_610324.2 PIH1 49..355 CDD:285409 49/303 (16%)
CG4022NP_001246696.1 alpha-crystallin-Hsps_p23-like 106..>196 CDD:294116 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22997
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.