DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop17l and Pih1d2

DIOPT Version :9

Sequence 1:NP_610324.2 Gene:Nop17l / 35730 FlyBaseID:FBgn0033224 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_001178722.1 Gene:Pih1d2 / 315645 RGDID:1310503 Length:315 Species:Rattus norvegicus


Alignment Length:338 Identity:81/338 - (23%)
Similarity:142/338 - (42%) Gaps:62/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FFDYVDEI--QDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTAL--DGELKCFINIASCE 102
            |:..:|::  .|||.   |.:.|.| |.:.|.:: ...|:|...::|.:  ..|...|||:...|
  Rat    15 FWSMLDDLAENDPER---YRNFIQQ-ELKDGKQL-CADPEPQLCLQTKILKPKEKVLFINLCQWE 74

  Fly   103 EIQRPKNEVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVFHPDALHLAMRNKQFRQ 167
            .|..|::  ||.|          :|:: ....:||...::.|.:.||.::|..|..|.:::..:.
  Rat    75 RIPAPQS--ATHP----------VPIS-VGRPEDFPETSDACTIIDVAYNPGVLQAAEKDQGIKD 126

  Fly   168 CLIDTALDAIEREYKVSLD----------RANLKFPKLDYKGIPR--PTVIRKMADNPTAEE--- 217
            .||..|:..||...:::|.          :.:::..|....||..  |.....|..:.|.|.   
  Rat   127 QLIRMAMRCIEERLQLTLAHSYHVTHFRVKGSIQRMKERLMGIKTHFPNFKEMMRKDNTLERIRS 191

  Fly   218 ---QEPHPLAHMFPTKPPAPGKQEPRVLPMKTKPSPVP-EFTVPRYTIKHSHDVDLSEYTDELDA 278
               .||..|..:..||.....|  .|.|..:...|.|. |...|.|.:|...|.:          
  Rat   192 STVSEPSHLPEVLLTKKQVSAK--GRCLIEEIASSEVQVEAKTPAYELKVVKDQN---------- 244

  Fly   279 KLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIYL-FSERQGAKYRLKLDLPFIVDDKAGRARF 342
                ..|..:.:::|||.:::.:.|:|.|:...:.: .||    .|||.|:||..::.:...|:|
  Rat   245 ----EKPLKIELKVELPGIKAVSLCELSVSEVDLLIEVSE----MYRLCLNLPESINTEMTTAKF 301

  Fly   343 DTDMRRLSITLPV 355
            ..:...|.||:|:
  Rat   302 IKNKSILIITMPL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop17lNP_610324.2 PIH1 49..355 CDD:285409 78/329 (24%)
Pih1d2NP_001178722.1 alpha-crystallin-Hsps_p23-like 25..313 CDD:294116 78/325 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.