DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop17l and PIH1D2

DIOPT Version :9

Sequence 1:NP_610324.2 Gene:Nop17l / 35730 FlyBaseID:FBgn0033224 Length:834 Species:Drosophila melanogaster
Sequence 2:XP_016872690.1 Gene:PIH1D2 / 120379 HGNCID:25210 Length:316 Species:Homo sapiens


Alignment Length:323 Identity:74/323 - (22%)
Similarity:133/323 - (41%) Gaps:61/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FFDYVDEI--QDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTAL--DGELKCFINIASCE 102
            |::.:|::  .|||.   ||..|.|..|| |.:: ...|:|...::|.:  ..|...|||:  |:
Human    15 FWNLLDDLAQSDPEG---YEKFIQQQLKE-GKQL-CAAPEPQLCLQTRILKPKEKILFINL--CQ 72

  Fly   103 EIQRPKNEVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVFHPDALHLAMRNKQFRQ 167
            ..:.|..:..|.|          :|:......|..:..:.: .|.||.::||.||.|.:::..:.
Human    73 WTRIPAPQSTTHP----------VPLTVGKPEDTTEISDAY-TVIDVAYNPDVLHAAEKDQVKKN 126

  Fly   168 CLIDTALDAIEREYKVSLD----------RANLKFPKLDYKGIPRPTV-IR-KMADNPTAEE--- 217
            .||..|:..||.:::.:|.          :.:::..|.:..||...:: :| ||....|..:   
Human   127 QLIQMAMKCIEEKFQFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRS 191

  Fly   218 ---QEPHPLAHMFPTKPPAPGKQEPRVLPMKTKPSPVPEFTVPRYTIKHSHDVDLSEYTDELDAK 279
               ..|.....:...|....||....:..:.:....| |..:|.|.:|..||             
Human   192 STMSNPDHFPQLLLPKDQVSGKAVCLIEEISSTEIQV-EMKMPAYELKIVHD------------- 242

  Fly   280 LHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIY--LFSERQ----GAKYRLKLDLPFIVDDK 336
             |...|..:.:::|||.:.|.:.|.|.|:....:  |.|:.|    |..:..:.|..|.:|:|
Human   243 -HSEKPLKIELKVELPGINSVSLCDLSVSETMPWDTLTSQSQASELGINHLTEPDHTFHLDNK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop17lNP_610324.2 PIH1 49..355 CDD:285409 72/316 (23%)
PIH1D2XP_016872690.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.