DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12825 and CG12824

DIOPT Version :9

Sequence 1:NP_610322.1 Gene:CG12825 / 35726 FlyBaseID:FBgn0033221 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001097214.1 Gene:CG12824 / 35727 FlyBaseID:FBgn0033222 Length:142 Species:Drosophila melanogaster


Alignment Length:145 Identity:71/145 - (48%)
Similarity:89/145 - (61%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEMGIHISALQILGSVVLIVGAIKQKHK 65
            |||.|:|.||||||..||..||.||::..:.  :...|..|:||:::||:.|.|||.||||::||
  Fly     1 MWKPDSKAGIICSGAASICLAIAYLIIFANL--RELSYAFGVHIASMQIISSAVLIGGAIKERHK 63

  Fly    66 FFVPWMITTGFFLYLMVNLFISLIVQGTAWIFGPLMVVPFTAYLGCALYSVQKAFDRMRKEE-PP 129
            .||||||||..|||||....|.|:..|. |:.......|....||.|.|:|||||.||||:. ||
  Fly    64 LFVPWMITTAMFLYLMGYSSIVLLAMGD-WLIVMFCAAPMIGCLGMAFYAVQKAFRRMRKDGLPP 127

  Fly   130 AYASLSDKKEFINHI 144
            .||.:..|...:|.|
  Fly   128 KYADMQVKSILVNPI 142



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.