DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cn and COQ6

DIOPT Version :9

Sequence 1:NP_523651.4 Gene:cn / 35724 FlyBaseID:FBgn0000337 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_011771.1 Gene:COQ6 / 853170 SGDID:S000003487 Length:479 Species:Saccharomyces cerevisiae


Alignment Length:369 Identity:70/369 - (18%)
Similarity:135/369 - (36%) Gaps:132/369 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RMLHDVRGNS-SVVLYDPINN-QCLYSVGRRQLNEVLLNACDK---------------LPNIRCH 152
            |.:|.:..|: :.:::|.|.: ..||          :.:.|.|               :.||:..
Yeast    90 RSIHFLENNAGATLMHDRIQSYDGLY----------VTDGCSKATLDLARDSMLCMIEIINIQAS 144

  Fly   153 FEHKLTSANLREGSMEFRNPAKEAVAAHAD---------------------LIVGCDGAFSSVRQ 196
            ..::::..:.::.|::..:..|.....|:|                     |:||.|| |:|..:
Yeast   145 LYNRISQYDSKKDSIDIIDNTKVVNIKHSDPNDPLSWPLVTLSNGEVYKTRLLVGADG-FNSPTR 208

  Fly   197 NNVRLP--GFNYS--------------------QEYIETGYLELCIPSKSGDFQMPANYLH-IW- 237
            ...::|  |:.|:                    |.::.||.:        ....||.|... :| 
Yeast   209 RFSQIPSRGWMYNAYGVVASMKLEYPPFKLRGWQRFLPTGPI--------AHLPMPENNATLVWS 265

  Fly   238 --PRNTFMMIALPNQDKSFTVTLSMPF---------------------------------EIFAG 267
              .|.:.::::||  .:|||..::..|                                 ||:|.
Yeast   266 SSERLSRLLLSLP--PESFTALINAAFVLEDADMNYYYRTLEDGSMDTDKLIEDIKFRTEEIYAT 328

  Fly   268 IQNQNDLLEFFKLNFRDALPLIGEQQLIKDFFKTRPQFLVSIKCRPYHYADKALILGDAAHAMVP 332
            :::::|:.|.:            ..:::....|||.:|.:.:.....:..|:..::|||||...|
Yeast   329 LKDESDIDEIY------------PPRVVSIIDKTRARFPLKLTHADRYCTDRVALVGDAAHTTHP 381

  Fly   333 YYGQGMNAGMEDVTLLTDILAKQLP--LDETLALFTESRWQDAF 374
            ..|||:|.|..||..|...|.|.:.  ||...:|..|..|.:.:
Yeast   382 LAGQGLNMGQTDVHGLVYALEKAMERGLDIGSSLSLEPFWAERY 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnNP_523651.4 UbiH 31..411 CDD:223727 70/369 (19%)
NADB_Rossmann 31..353 CDD:304358 63/344 (18%)
COQ6NP_011771.1 COQ6 28..471 CDD:273914 70/369 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.