DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cn and AT4G15765

DIOPT Version :9

Sequence 1:NP_523651.4 Gene:cn / 35724 FlyBaseID:FBgn0000337 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_680702.4 Gene:AT4G15765 / 827256 AraportID:AT4G15765 Length:271 Species:Arabidopsis thaliana


Alignment Length:273 Identity:58/273 - (21%)
Similarity:96/273 - (35%) Gaps:88/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VAVIGAGLVGSLAALNFARMGNHVDLYEYREDIRQALVVQGRS--INLALSQRGRKALAAVGLEQ 93
            :.::|.|:.|...:|...|.|....:.|..|.:|.    :|.:  |...|.::|.|...:||   
plant     6 IVIVGGGIAGLATSLALHRKGIKSVVLERSESVRS----EGAAFWIRDVLIEKGIKRRESVG--- 63

  Fly    94 EVLATAIPMRGRMLHDVRGNSSVVLYDPINNQCLYSVGRRQLNEVLLNACDKLP----NIRCHFE 154
                      .....:|||                 |.|..|...|.:|   ||    .:.||  
plant    64 ----------PASYGEVRG-----------------VLRNDLVRALAHA---LPLGTLRLGCH-- 96

  Fly   155 HKLTSANLREGSMEFRNPAKEAVAAHADLIVGCDGAFSSVRQ----------NNVRLPGF-NYSQ 208
              :.|..|.|        .|.....|  :::||||:.|.|.:          .:..:.|| ||..
plant    97 --ILSVKLDE--------TKSFPIVH--VLIGCDGSNSVVSRFLGLNPTKDLGSRAIRGFTNYPD 149

  Fly   209 EYIETGYLELCIPSKSGDFQMPANYLHIWPRNTFMMIALPN--QDKSFTVTLSMPFEIFAGIQNQ 271
            ::   |:.:..|..|..:  :.:..|.|..:..|..:.|.|  ||.:|             ::||
plant   150 DH---GFRQEFIRIKMDN--VVSGRLPITHKLVFWFVVLRNCPQDSNF-------------LKNQ 196

  Fly   272 NDLLEFFKLNFRD 284
            .|:......:.|:
plant   197 EDIARLALASVRE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnNP_523651.4 UbiH 31..411 CDD:223727 58/273 (21%)
NADB_Rossmann 31..353 CDD:304358 58/273 (21%)
AT4G15765NP_680702.4 NADB_Rossmann 4..>126 CDD:304358 39/170 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462247at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.