DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cn and CTF2A

DIOPT Version :9

Sequence 1:NP_523651.4 Gene:cn / 35724 FlyBaseID:FBgn0000337 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_565814.1 Gene:CTF2A / 818135 AraportID:AT2G35660 Length:439 Species:Arabidopsis thaliana


Alignment Length:407 Identity:83/407 - (20%)
Similarity:140/407 - (34%) Gaps:119/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRRRVAVIGAGLVGSLAALNFARMGNHVDLYEYREDIRQALVVQGRSI-----NLALSQRGRKAL 86
            :..:|.::|||:.|...|::..|:|           ||..::.|..|:     :|.|.:.|.:.|
plant    43 QEEKVVIVGAGIGGLATAVSLHRLG-----------IRSVVLEQAESLRTGGTSLTLFKNGWRVL 96

  Fly    87 AAVGLEQEVLATAIPMRGRML--HDVRGNSSVVLYDPINNQCLYSVGRRQLNEVLLNACDKLPNI 149
            .|:.:..::....:.:.|.::  .|.|...|....|...:|.:.:|.||.|.|.|   ..:||..
plant    97 DAISVGPQLRTQFLEIEGMVVKKEDGRELRSFKFKDDDQSQEVRAVERRVLLETL---ASQLPPQ 158

  Fly   150 RCHFEHKLTS----AN----LREGSMEFRNPAKEAVAAHADLIVGCDGAFSSVRQNNVRLPGFNY 206
            ...|..||.|    ||    |:.|         :.....|.:::||||    :|.......||:.
plant   159 TIRFSSKLESIQSNANGDTLLQLG---------DGTRLLAQIVIGCDG----IRSKVATWMGFSE 210

  Fly   207 SQEYIETGYLELCIPSKSGDFQMPANYLH----------------IWPRNTFMMIALPNQDKSFT 255
            .:......|..|........||...||::                .|    |:....|:.....|
plant   211 PKYVGHCAYRGLGFYPNGQPFQKKVNYIYGKGIRAGYVPVSTTKVYW----FICFNSPSLGPKIT 271

  Fly   256 VTLSMPFEIFAGIQNQNDLLEFFKLNFRDALPLIGEQQLIKDFFKTRPQFLVSI----------- 309
            .                              |.|.::| .|:...|.|:.|.::           
plant   272 D------------------------------PAILKKQ-AKELVSTWPEDLQNLIDLTPDETISR 305

  Fly   310 ----------KCRPYHYADKALILGDAAHAMVPYYGQGMNAGMEDVTLLTDILAKQL-----PLD 359
                      ...|.....:.:::|||.|.|.|..|||....:||..:|.:.||..:     .::
plant   306 TPLVDRWLWPGIAPPASKGRVVLVGDAWHPMTPNLGQGACCALEDSVVLANKLANAINGGTESIE 370

  Fly   360 ETLALFTESRWQDAFAI 376
            ..:..:...||..||.:
plant   371 VAMESYGSERWSRAFPL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnNP_523651.4 UbiH 31..411 CDD:223727 83/403 (21%)
NADB_Rossmann 31..353 CDD:304358 77/373 (21%)
CTF2ANP_565814.1 UbiH 46..424 CDD:223727 83/404 (21%)
NADB_Rossmann 46..380 CDD:304358 79/395 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4322
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2577
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto4090
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.