DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cn and Coq6

DIOPT Version :9

Sequence 1:NP_523651.4 Gene:cn / 35724 FlyBaseID:FBgn0000337 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_608934.1 Gene:Coq6 / 33777 FlyBaseID:FBgn0031713 Length:477 Species:Drosophila melanogaster


Alignment Length:400 Identity:87/400 - (21%)
Similarity:156/400 - (39%) Gaps:93/400 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RQEPTEAARDERHGRRRRVAVIGAGLVGSLAALNFARMGNHVDLYEYREDIRQALVVQG----RS 73
            |.|.|::...|...    :.:.|.||||:..|...|:.....|        ::.|:::|    |.
  Fly    37 RGESTQSTSTEHFD----IIIGGGGLVGTTLAAALAKNSTLAD--------KKVLLLEGAPEFRG 89

  Fly    74 INLALSQRGRKALAAVGLEQEVLATAI------------PMRGRML------------HD-VRGN 113
            .|.....:.|  ::|:......|..:|            |::...:            || ...:
  Fly    90 FNPTGPYQNR--VSAINHNSIELFKSIDAWKHIESARYKPVKQMQVWESNTDALIQFQHDNFASD 152

  Fly   114 SSVVLYDPINNQCLYSVGRRQLNEVLLN----ACDKLPNIRCHFEHKLTSANLREGSME-FRNPA 173
            .:.::.:.:....:|::.:...|..:||    .|.:||        :.:::|..|..:| .||  
  Fly   153 VACIIENDLILDAVYALAKESPNVEILNKARIQCVRLP--------RDSNSNHSELQLEDGRN-- 207

  Fly   174 KEAVAAHADLIVGCDGAFSSVRQN-NVRLPGFNYSQ----EYIETGYLELCIPSKSGDFQMPANY 233
                 ...||::|.|||.|.||:. ||.:...||.:    ..:|.|. :.|..|.:....:|...
  Fly   208 -----FSCDLLIGADGANSVVRKEMNVDVFSLNYDRMGLVATLELGE-DACDNSVAWQRFLPNGP 266

  Fly   234 LHIWP---RNTFMMIALPNQDKSFTVTLSMPFEIFAGIQNQNDLLEFFKLNFRD----ALPLI-- 289
            :.:.|   |.:.::.:..|:.......|. |.| |....|:....::.::...|    ||..:  
  Fly   267 VALLPLTDRLSSLVWSTTNEQAKMLQALP-PTE-FVDALNEAFCRQYPRVELADKAVQALNSLFG 329

  Fly   290 --GEQQLIK---------DFFKTRPQFLVSIKCRPYHYADKALILGDAAHAMVPYYGQGMNAGME 343
              |.|..::         |  |:|..|.:.......:..:.|.::|||||.:.|..|||:|.|..
  Fly   330 HNGSQHQVQYPPRVCGVLD--KSRATFPLGFLHASSYVCNGAALVGDAAHRVHPLAGQGVNLGFS 392

  Fly   344 DVTLLTDILA 353
            ||..|.:.||
  Fly   393 DVRYLVESLA 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnNP_523651.4 UbiH 31..411 CDD:223727 82/381 (22%)
NADB_Rossmann 31..353 CDD:304358 81/380 (21%)
Coq6NP_608934.1 Ubi-OHases 58..476 CDD:273913 80/374 (21%)
COQ6 58..471 CDD:273914 80/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.