DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cn and Coq6

DIOPT Version :9

Sequence 1:NP_523651.4 Gene:cn / 35724 FlyBaseID:FBgn0000337 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001011983.1 Gene:Coq6 / 299195 RGDID:1311149 Length:476 Species:Rattus norvegicus


Alignment Length:376 Identity:78/376 - (20%)
Similarity:146/376 - (38%) Gaps:72/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VAVIGAGLVGSLAALNFARMGNHVDLYEYREDIRQALVVQGRSINL-ALSQRGRKALAAVGLEQE 94
            |.|.|.|:|||..|   ..:|:.:..:    |.:..|:..|....| .||:.....::::.|...
  Rat    46 VVVSGGGMVGSAMA---CALGHDIHFH----DKKILLLEAGPKKTLEKLSETYSNRVSSISLGST 103

  Fly    95 VLATAI-------PMRGRMLHDVR----GNSSVVLYDPINNQCLYSVGRRQLNEVLLNACDK--- 145
            .|.::.       .||.:....::    .:.:::::|..|   |..:|....|:|:::|..|   
  Rat   104 TLLSSFGAWDHICNMRCKAFRRMQVWDSCSEALIMFDKDN---LDDMGYIVENDVIMHAITKQLE 165

  Fly   146 --LPNIRCHFEHKLTS------ANLREGSMEFRNPAKEAVAAHADLIVGCDGAFSSVRQ----NN 198
              ...::..:|.|...      .:|.:.|........:.......|::|.||..|.|||    .|
  Rat   166 AVADRVKVLYESKAVGYAWPGPFSLADSSPWVHITLGDGSTLQTKLLIGADGHNSGVRQAAGIQN 230

  Fly   199 VRLPGFNYSQEYIETGYLELCIPSKSG-DFQ--MPANYLHIWP-RNTFMMIALPNQDKSFTVTLS 259
            |   |:||.|..: ...|.|...:::. .:|  :|:..:.:.| .:|...:............:|
  Rat   231 V---GWNYDQSAV-VATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHAHAAELVS 291

  Fly   260 MPFEIF----------------------AGIQNQNDLLEFFKLNFRDALPLIGEQQLIKDFFKTR 302
            |..|.|                      |.:.:...||:..|::.|...|.:.:...     |:|
  Rat   292 MHEEEFVDAINSAFWSDVHHTDFVDSASAMVHHAVALLKPTKVSARQLPPSVAKVDA-----KSR 351

  Fly   303 PQFLVSIKCRPYHYADKALILGDAAHAMVPYYGQGMNAGMEDVTLLTDILA 353
            ..|.:.:.....:...:..::|||||.:.|..|||:|.|..|::.|...|:
  Rat   352 ALFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLIHYLS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnNP_523651.4 UbiH 31..411 CDD:223727 78/376 (21%)
NADB_Rossmann 31..353 CDD:304358 77/374 (21%)
Coq6NP_001011983.1 Ubi-OHases 57..475 CDD:273913 71/365 (19%)
NADB_Rossmann 57..471 CDD:304358 71/365 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.