Sequence 1: | NP_610319.2 | Gene: | CG1946 / 35720 | FlyBaseID: | FBgn0033216 | Length: | 349 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_189317.1 | Gene: | AT3G26820 / 822297 | AraportID: | AT3G26820 | Length: | 634 | Species: | Arabidopsis thaliana |
Alignment Length: | 216 | Identity: | 52/216 - (24%) |
---|---|---|---|
Similarity: | 86/216 - (39%) | Gaps: | 59/216 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 PFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSHPGQYILT 216
Fly 217 LKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDS-SLRRFQNVVKKFT------------ 268
Fly 269 -------GISP-LLPKGRGIFNYNYGILPHRRRIVQVVGSPIDV--ERCETPDPEYVDKIH---- 319
Fly 320 GQVIDALA-----RMFDEYKE 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1946 | NP_610319.2 | LPLAT | 80..349 | CDD:302626 | 52/216 (24%) |
AT3G26820 | NP_189317.1 | Abhydrolase_1 | 88..336 | CDD:278959 | |
Abhydrolase_5 | <150..>183 | CDD:289465 | |||
LPLAT_MGAT-like | 397..599 | CDD:153249 | 48/201 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1347007at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |