DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and AT3G26820

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_189317.1 Gene:AT3G26820 / 822297 AraportID:AT3G26820 Length:634 Species:Arabidopsis thaliana


Alignment Length:216 Identity:52/216 - (24%)
Similarity:86/216 - (39%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSHPGQYILT 216
            |.:.|..:..|.|.||..:...||   .:..|           |.:..||.:||:.....:|.|.
plant   424 PKMFDKYKLMGGVPVSNMNFYKLL---REKAH-----------VLLYPGGVREALHRKGEEYKLF 474

  Fly   217 LKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDS-SLRRFQNVVKKFT------------ 268
            ..::..||::|.:.|:.|||....||.|||:.|.:..|. ::...:::::|.|            
plant   475 WPEQSEFVRVASKFGAKIVPFGVVGEDDIFNIVLDSNDQRNIPILKDLMEKATKDAGNLRWKETK 539

  Fly   269 -------GISP-LLPKGRGIFNYNYGILPHRRRIVQVVGSPIDV--ERCETPDPEYVDKIH---- 319
                   .|.| |:||..|.|.|.:             |.|||:  :..|..|.|...:::    
plant   540 ANWETKIAIIPGLVPKIPGRFYYYF-------------GKPIDLAGKEKELKDKEKAQEVYLQAK 591

  Fly   320 GQVIDALA-----RMFDEYKE 335
            .:|...:|     |..|.|::
plant   592 SEVEQCIAYLKMKRECDPYRQ 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 52/216 (24%)
AT3G26820NP_189317.1 Abhydrolase_1 88..336 CDD:278959
Abhydrolase_5 <150..>183 CDD:289465
LPLAT_MGAT-like 397..599 CDD:153249 48/201 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.