DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Mogat3

DIOPT Version :10

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001064308.2 Gene:Mogat3 / 685560 RGDID:1592588 Length:84 Species:Rattus norvegicus


Alignment Length:80 Identity:28/80 - (35%)
Similarity:46/80 - (57%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 ISPLLPKGRGIFNYNYGIL-PHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEY 333
            :|..||    :|:...|:| |.|..|..|||:||.|:|...|..|.|:::|...::.|.::|:|:
  Rat     9 LSVALP----LFHGRLGLLIPFRVPIHTVVGAPIPVQRSPRPTREQVNRLHELYVERLTQLFEEH 69

  Fly   334 KEKY-TPNSKHIKLI 347
            |.:| .|..:|:..|
  Rat    70 KMRYGVPADQHLVFI 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:473073 28/80 (35%)
Mogat3XP_001064308.2 LPLAT <2..83 CDD:473073 27/77 (35%)

Return to query results.
Submit another query.