DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Mogat2

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001102906.2 Gene:Mogat2 / 681211 RGDID:1598060 Length:334 Species:Rattus norvegicus


Alignment Length:350 Identity:135/350 - (38%)
Similarity:207/350 - (59%) Gaps:26/350 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLL--LIYFVKIYLDY 65
            :|:|||.||.||||||.....:.::|..|     ..:.|.::.|.:|.|..|  ::|....|||:
  Rat     2 VEFAPLLVPWERRLQTFAVLQWVFSFLAL-----AQLCIFIFIGLLFTRFWLFSVLYATWWYLDW 61

  Fly    66 KR-NYGIMEGNGWLFYR--SNWRY-RNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSL 126
            .| ..|   |....|:|  :.|:| :::|||.|||||||.|:||||....|||:|..|..:|:..
  Rat    62 DRPRQG---GRPIQFFRRMAIWKYMKDFFPVSLVKTAELDPSRNYIAGFHPHGVLAAGAFLNLCT 123

  Fly   127 DIDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFT 191
            :...:.||:|.:|..:..|...|:.|..||.:...|:||..|.|..::||:...           
  Rat   124 ESTGFTSLFPGIRSYLMMLTVWFRAPIFRDYIMSGGLVSSEKVSADHILSRKGG----------- 177

  Fly   192 SNAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSS 256
            .|.:|::||||:||:|:.||.|.|.||:||||:::|:..|:::||..||||.::|:||.|.|.:.
  Rat   178 GNLLAIIVGGAQEALDARPGAYRLLLKNRKGFIRLALTHGAALVPIFSFGENNLFNQVENTPGTW 242

  Fly   257 LRRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQ 321
            ||..||.::|..|||..|..|||:|.|::|::|.|:.|..|||.||:|:....|..|.|:::|..
  Rat   243 LRWIQNWLQKIMGISLPLFHGRGVFQYSFGLVPFRQPITTVVGKPIEVQMIPHPSEEEVNRLHQL 307

  Fly   322 VIDALARMFDEYKEKY-TPNSKHIK 345
            .|..|.::|:|:|.|: .|..:|::
  Rat   308 YIKELCKLFEEHKLKFNVPEDQHLE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 108/269 (40%)
Mogat2NP_001102906.2 LPLAT 41..333 CDD:418432 119/305 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340455
Domainoid 1 1.000 212 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57020
Inparanoid 1 1.050 236 1.000 Inparanoid score I3307
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm9114
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X186
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.