DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Awat1

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001102841.1 Gene:Awat1 / 679520 RGDID:1587163 Length:328 Species:Rattus norvegicus


Alignment Length:327 Identity:111/327 - (33%)
Similarity:172/327 - (52%) Gaps:43/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDYKR-NYGIMEGNGWLF 79
            :|.|..|.|....:.||                   ||.:::|:   ||:|. |.| ...:.|: 
  Rat    29 VQPLFFSLFFTPLWLLP-------------------SLYVVWFI---LDWKTPNQG-GRRSAWV- 69

  Fly    80 YRSNW----RYRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRP 140
              .||    ..|:|||:.::||.:|.|::|||:...|||:|..|...|...:...:...:|.:.|
  Rat    70 --RNWNIWTHIRDYFPITILKTKDLSPSQNYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITP 132

  Fly   141 KIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEA 205
            .:|||...||.|.:||.:...|:.|||:.|:.||||..            |.|.|.::|||..||
  Rat   133 HLATLSWFFKIPLIRDYIMAKGVCSVSQASIDYLLSHG------------TGNLVGIVVGGVGEA 185

  Fly   206 MDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGI 270
            :.|.|....|.||.|||||:.|:|.|:.:||:.:|||.:::|||....:|.:.:||:..::..|.
  Rat   186 LQSVPNTTTLILKKRKGFVRTALRHGAHLVPTFTFGETEVYDQVVFHEESRMFKFQSFFRRIFGF 250

  Fly   271 SPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEYKE 335
            ...:..|:|......|:||:.|.||.|||.|:.:.:.:.|.||.|||.|...:|||.::|:::|.
  Rat   251 YFCVFYGQGFHQECKGLLPYHRPIVTVVGEPLPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKV 315

  Fly   336 KY 337
            :|
  Rat   316 QY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 96/262 (37%)
Awat1NP_001102841.1 LPLAT 34..327 CDD:302626 109/322 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340452
Domainoid 1 1.000 212 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3307
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm9114
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X186
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.