DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Dgat2

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_080660.1 Gene:Dgat2 / 67800 MGIID:1915050 Length:388 Species:Mus musculus


Alignment Length:338 Identity:113/338 - (33%)
Similarity:193/338 - (57%) Gaps:17/338 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDYK 66
            ::.|.. |..:|::||.:....:..:|..|.: :|..:.:..:..:.::  :.::||..:..|:.
Mouse    55 SVTWLN-RSKVEKQLQVISVLQWVLSFLVLGV-ACSVILMYTFCTDCWL--IAVLYFTWLAFDWN 115

  Fly    67 RNYGIMEGNGWLFYRSNWRY-RNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDN 130
            ........:.|:...:.||| |:|||::||||..|...||||....||||:|.|...|.|.:...
Mouse   116 TPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE 180

  Fly   131 WLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAV 195
            ....:|.:||.:|||..:|:.|.||:.|...|:..|:::::.|||||:.           :.||:
Mouse   181 VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNG-----------SGNAI 234

  Fly   196 AVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRF 260
            .::||||.|::.|.||:..:|||:||||||:|:|.|:.:||:.||||.:::.||.....|..|..
Mouse   235 IIVVGGAAESLSSMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWV 299

  Fly   261 QNVVKKFTGISPLLPKGRGIFNYN-YGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVID 324
            |...:|:.|.:|.:..|||:|:.: :|::|:.:.|..|||.||.|.:.|.|..:.:|..|...::
Mouse   300 QKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYME 364

  Fly   325 ALARMFDEYKEKY 337
            ||.::||.:|.|:
Mouse   365 ALVKLFDNHKTKF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 101/260 (39%)
Dgat2NP_080660.1 DAGAT 92..388 CDD:112781 105/299 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836751
Domainoid 1 1.000 217 1.000 Domainoid score I2664
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3298
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8869
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.