DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and dgat2

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_989372.1 Gene:dgat2 / 395003 XenbaseID:XB-GENE-1017054 Length:361 Species:Xenopus tropicalis


Alignment Length:325 Identity:111/325 - (34%)
Similarity:179/325 - (55%) Gaps:16/325 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDYKRNYGIMEGNGWL 78
            |.||.:....:..:|..|.: :|.||.:.::..::::  :..:|...:.||:...|.....:.|:
 Frog    39 RHLQIISVLQWVLSFLILGV-ACTAVLVYIFCTDLWL--IAALYLTWMVLDWNTPYKGGRRSSWV 100

  Fly    79 FYRSNWRY-RNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKI 142
            ...:.||| |:|||::||||..|.|:||||....||||:..|...|...:.......:|.::..:
 Frog   101 RNWAVWRYFRDYFPIKLVKTHNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHL 165

  Fly   143 ATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMD 207
            |||..:|:.|.||:.|...|:..|:::::.|:|||:.           |.|||.:.||||.|:::
 Frog   166 ATLAGNFRMPVLREYLMSGGICPVARDTIDYILSKNG-----------TGNAVVIAVGGAAESLN 219

  Fly   208 SHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGISP 272
            ..||:..:|||.||||||:|::.|:.:||..||||.:.:.||.....|..|..|...:|:.|.:|
 Frog   220 CRPGKNTVTLKQRKGFVKVALQHGADLVPVYSFGENEAYKQVVFEEGSWGRWIQKKFQKYVGFAP 284

  Fly   273 LLPKGRGIFNYN-YGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEK 336
            .|..|...|:.| :|::|:...|..|||.||.|.:.|.|..:.|:..|...:.:|.|:||:||.|
 Frog   285 CLFHGCSFFSSNSWGLVPYANPITTVVGEPITVPKIEQPTQKDVELYHAMYVTSLQRLFDKYKTK 349

  Fly   337  336
             Frog   350  349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 98/259 (38%)
dgat2NP_989372.1 DAGAT 66..360 CDD:112781 103/297 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 207 1.000 Domainoid score I2814
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3362
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.110

Return to query results.
Submit another query.