DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Dgat2

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster


Alignment Length:351 Identity:236/351 - (67%)
Similarity:283/351 - (80%) Gaps:3/351 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDY 65
            |.|||||||||||||||.|||:|||.....|...|.|.||..|.||.:.||||::.|...:::.:
  Fly     1 MKIEWAPLRVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGLLVRSLMVTYLAYVFVHH 65

  Fly    66 KRNYGIMEGNGWLFYRSNW---RYRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLD 127
            |:...:::||||:..|:|.   .||:|||||||||||||..:|||:|||||||||||..|||.|:
  Fly    66 KKTQSVVDGNGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLE 130

  Fly   128 IDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTS 192
            |..||.|:|.||||:.|||.||..||:|::||.||:||||||:|..:|||||||.||||||||||
  Fly   131 ISKWLELFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTS 195

  Fly   193 NAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSL 257
            ||||:|||||:|||||||||||||||:|||||:||:|||||||||.|||||||||||||||:|.|
  Fly   196 NAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLL 260

  Fly   258 RRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQV 322
            ||||:.|||.||:|||:|.|||.|||.:|.||.|||||||||:||||.:.|.||.|||||:||||
  Fly   261 RRFQDFVKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQV 325

  Fly   323 IDALARMFDEYKEKYTPNSKHIKLII 348
            |::|.::||:||:||..|||...|::
  Fly   326 IESLEKLFDQYKDKYLENSKSATLVV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 196/272 (72%)
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 194/265 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448347
Domainoid 1 1.000 93 1.000 Domainoid score I2557
eggNOG 1 0.900 - - E1_KOG0831
Homologene 1 1.000 - - H57020
Inparanoid 1 1.050 93 1.000 Inparanoid score I2247
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm6422
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - P PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
1413.840

Return to query results.
Submit another query.