DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and MOGAT3

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_005250366.1 Gene:MOGAT3 / 346606 HGNCID:23249 Length:344 Species:Homo sapiens


Alignment Length:288 Identity:110/288 - (38%)
Similarity:161/288 - (55%) Gaps:24/288 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDYKR-NYGIMEGNGWLFY 80
            |.::|..|...||:      |.|.:||:..   :....:.|.|.:|:|:.. |.|..... |:..
Human    28 QYVLTFLFMGPFFS------LLVFVLLFTS---LWPFSVFYLVWLYVDWDTPNQGGRRSE-WIRN 82

  Fly    81 RSNWR-YRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIAT 144
            |:.|| .|:|:||:|||||||||:|||::.:.||||:.||...|.|.:.:.:..|:|.:||.:|.
Human    83 RAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAV 147

  Fly   145 LDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSH 209
            |...|..|..||.:..:|:..||::||.::||:..           ...||.::||||.||:.|.
Human   148 LAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQ-----------LGQAVVIMVGGAHEALYSV 201

  Fly   210 PGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGISPLL 274
            ||::.|||:.|||||::|:|.|:|:||..||||.|||...|....|.....|...||..|.||.:
Human   202 PGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCI 266

  Fly   275 PKGRGIFN-YNYGILPHRRRIVQVVGSP 301
            ..|||:|: .::|:||....|..|...|
Human   267 FWGRGLFSATSWGLLPFAVPITTVGECP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 94/224 (42%)
MOGAT3XP_005250366.1 LPLAT 45..290 CDD:327403 101/259 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146790
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.