DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Dgat2

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001012345.1 Gene:Dgat2 / 252900 RGDID:620329 Length:388 Species:Rattus norvegicus


Alignment Length:341 Identity:117/341 - (34%)
Similarity:190/341 - (55%) Gaps:23/341 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLI---YFVKIYL 63
            ::.|.. |..:|:.||.:....:..:|..|.:    |.:::|.|  .|.....||   ||..:..
  Rat    55 SVTWLN-RSKVEKHLQVISVLQWVLSFLVLGV----ACSVILMY--TFCTDCWLIAALYFTWLAF 112

  Fly    64 DYKRNYGIMEGNGWLFYRSNWRY-RNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLD 127
            |:.........:.|:...:.||| |:|||::||||..|...||||....||||:|.|...|.|.:
  Rat   113 DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTE 177

  Fly   128 IDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTS 192
            .......:|.:||.:|||..:|:.|.||:.|...|:..|:::::.|||||:.           :.
  Rat   178 ATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNG-----------SG 231

  Fly   193 NAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSL 257
            ||:.::||||.|::.|.||:..:||::||||||:|:|.|:.:||:.||||.:::.||.....|..
  Rat   232 NAIVIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWG 296

  Fly   258 RRFQNVVKKFTGISPLLPKGRGIFNYN-YGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQ 321
            |..|...:|:.|.:|.:..|||:|:.: :|::|:.:.|..|||.||.|.:.|.|..:.:|..|..
  Rat   297 RWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHTM 361

  Fly   322 VIDALARMFDEYKEKY 337
            .::||.::||.:|.|:
  Rat   362 YMEALVKLFDNHKTKF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 100/260 (38%)
Dgat2NP_001012345.1 DAGAT 92..388 CDD:112781 108/299 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340461
Domainoid 1 1.000 212 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3307
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm9114
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X186
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.