DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and Awat1

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001074605.1 Gene:Awat1 / 245533 MGIID:3588200 Length:328 Species:Mus musculus


Alignment Length:310 Identity:106/310 - (34%)
Similarity:169/310 - (54%) Gaps:27/310 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LYYGEMF--VRSLLL------------IYFVKIYLDYKRNYGIMEGNGWLFYRSNWRY-RNYFPV 92
            |.|..||  |:.||:            :|||.:.||:|........:.|:...:.|.: |:|||:
Mouse    20 LSYVAMFWIVQPLLICLLFTPLWPLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVWNHIRDYFPI 84

  Fly    93 ELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIATLDHHFKTPFLRDI 157
            .::||.:|.|:.|||:...|||:|..|...|...:...:...:|.:.|.:|||...||.|.:||.
Mouse    85 TILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPIIRDY 149

  Fly   158 LRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSHPGQYILTLKDRKG 222
            :...|:.|||:.|:.||||..            |.|.|.::|||..||:.|.|....|.||.|||
Mouse   150 IMAKGLCSVSQASIDYLLSHG------------TGNLVGIVVGGVGEALQSVPNTTTLLLKKRKG 202

  Fly   223 FVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGISPLLPKGRGIFNYNYGI 287
            ||:.|::.|:.:||:.:|||.:::|||....||.:.:||::.::..|....:..|:|......|:
Mouse   203 FVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDCKGL 267

  Fly   288 LPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEKY 337
            ||:.:.|:.|||..:.:.:.:.|.||.|||.|...:|||.::|:::|.:|
Mouse   268 LPYHKPIITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 92/259 (36%)
Awat1NP_001074605.1 LPLAT 36..327 CDD:302626 99/294 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836754
Domainoid 1 1.000 217 1.000 Domainoid score I2664
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3298
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8869
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.870

Return to query results.
Submit another query.