DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1946 and dgat2l6

DIOPT Version :9

Sequence 1:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_002934939.1 Gene:dgat2l6 / 100127752 XenbaseID:XB-GENE-5928098 Length:361 Species:Xenopus tropicalis


Alignment Length:321 Identity:115/321 - (35%)
Similarity:175/321 - (54%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FTLPISSCLAVAILLYYGEMFVRSL---LLIYFVKIYLDY-------KRNYGIMEGNGWLFYRSN 83
            |:..:...||:.||:|   :|...|   ..:|...|.||:       :|::       |:...:.
 Frog    51 FSFLVMGLLALVILIY---LFFTGLWPVSALYISWILLDWDTPETGGRRSH-------WVRNWAI 105

  Fly    84 WRY-RNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIATLDH 147
            |.| |:|||::||||..|||.||||:.|.|||||......|.|.:...:...:|.:||.:|||..
 Frog   106 WNYFRDYFPIKLVKTHSLPPGRNYIIGSHPHGILCIAAFCNFSTESTGFSKKFPGIRPYLATLAG 170

  Fly   148 HFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSHPGQ 212
            :|:.|.||:.:...|:..|:::::||:||:|.           ..|||.::||||.|::...||.
 Frog   171 NFRLPLLREYMMSGGLCPVNRKAISYVLSQSG-----------CGNAVVIVVGGAAESLSCQPGI 224

  Fly   213 YILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGISPLLPKG 277
            ..:.|..|:|||::|:..|:.:|||.||||.:::.||..|..|.||..|...:|..|.:|....|
 Frog   225 TTVILSRRRGFVRLALEQGADLVPSFSFGENELYQQVQFPEQSILRTAQWKFQKLFGFAPCFFYG 289

  Fly   278 RGIFNY-NYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEKY 337
            |||.:. :.|.||:.|.|..|||.||.|.:.:.|.|:.||..|.....:|.::|.|:|.:|
 Frog   290 RGITSIESKGFLPYPRPITTVVGEPISVPKIQDPSPQTVDLYHNMYKCSLLKLFHEHKTQY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 101/260 (39%)
dgat2l6XP_002934939.1 DAGAT 66..360 CDD:112781 110/306 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 207 1.000 Domainoid score I2814
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3362
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.