DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgat2 and DGAT2

DIOPT Version :9

Sequence 1:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_115953.2 Gene:DGAT2 / 84649 HGNCID:16940 Length:388 Species:Homo sapiens


Alignment Length:339 Identity:126/339 - (37%)
Similarity:190/339 - (56%) Gaps:29/339 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGL------LVRSLMVTYLAYVFVHHKK 67
            |..:|::||::      |:|..:||...|.||.|.|...:      |:..|..|:|.:.:...||
Human    61 RSKVEKQLQVI------SVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKK 119

  Fly    68 TQSVVDGNGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLEIS 132
                 .|......|...:.|::|||||::||||..|..|:|||....||||:|.|...|...|.:
Human   120 -----GGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEAT 179

  Fly   133 KWLELFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNA 197
            :..:.||.:||.|.||..:|.:|.:||.|...|:..||::.:..:|||:.           :.||
Human   180 EVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNG-----------SGNA 233

  Fly   198 VAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRR 262
            :.|:||||.|::.|.||:..:||:||||||::|:|.|:.:||.:||||.:::.||.....|..|.
Human   234 IIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRW 298

  Fly   263 FQDFVKKLTGVSPLIPVGRGFFNY-TFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQVI 326
            .|...:|..|.:|.|..|||.|:. |:|.:|:.:.|..|||.||.:.|.|||..:.:|..|...:
Human   299 VQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYM 363

  Fly   327 ESLEKLFDQYKDKY 340
            |:|.||||::|.|:
Human   364 EALVKLFDKHKTKF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 106/266 (40%)
DGAT2NP_115953.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..40
DAGAT 92..388 CDD:112781 113/302 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146806
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.