DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgat2 and AT3G26820

DIOPT Version :9

Sequence 1:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_189317.1 Gene:AT3G26820 / 822297 AraportID:AT3G26820 Length:634 Species:Arabidopsis thaliana


Alignment Length:289 Identity:69/289 - (23%)
Similarity:109/289 - (37%) Gaps:75/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HRHYRDYF---PVELVKTAE-----LPATKNYILASFPHGILGTGIGINM-GLEISKWLELFPQV 141
            |.:..||.   |.||.:..:     :.|....:|::...|:|.....|:| ||....   :|..:
plant   356 HDYVSDYIKPTPFELQQLLDEHRLLMDAISPVMLSTLEDGLLLKERNIHMRGLTHPM---VFMYI 417

  Fly   142 RPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAILVGGAQ 206
            :..|  :|     |.|.:..:..|.|.||.....::|   .:..|           |.:..||.:
plant   418 QDSL--VD-----PKMFDKYKLMGGVPVSNMNFYKLL---REKAH-----------VLLYPGGVR 461

  Fly   207 EAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSL-LRRFQDFVKKL 270
            ||:.....:|.|....:..|||:|.:.|:.|||....||.|||:.|.:..:.. :...:|.::|.
plant   462 EALHRKGEEYKLFWPEQSEFVRVASKFGAKIVPFGVVGEDDIFNIVLDSNDQRNIPILKDLMEKA 526

  Fly   271 T-----------------------GVSPLIPVGRGFFNYTFGFLPFRRRIVQVVGAPIDVV--KN 310
            |                       |:.|.||   |.|.|.|             |.|||:.  :.
plant   527 TKDAGNLRWKETKANWETKIAIIPGLVPKIP---GRFYYYF-------------GKPIDLAGKEK 575

  Fly   311 EHPDSEYVDKVHGQVIESLEKLFDQYKDK 339
            |..|.|...:|:.|....:|:.....|.|
plant   576 ELKDKEKAQEVYLQAKSEVEQCIAYLKMK 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 69/289 (24%)
AT3G26820NP_189317.1 Abhydrolase_1 88..336 CDD:278959
Abhydrolase_5 <150..>183 CDD:289465
LPLAT_MGAT-like 397..599 CDD:153249 58/241 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.