DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgat2 and MOGAT2

DIOPT Version :9

Sequence 1:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011543569.1 Gene:MOGAT2 / 80168 HGNCID:23248 Length:336 Species:Homo sapiens


Alignment Length:303 Identity:120/303 - (39%)
Similarity:171/303 - (56%) Gaps:26/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IEWAPLRVPLERRLQIL-VTAFFTSMLLI--LLSVSFLLVAGSLIYGGLLVR--SLMVTYLAYVF 62
            :|:|||.:|.|||||.| |..|..|.|.:  :.:|.|:.:        |..|  .|.|.|.|:.:
Human     2 VEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIAL--------LFTRFWLLTVLYAAWWY 58

  Fly    63 VHHKKTQSVVDGNGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINM 127
            :...|.:.  .|......|...:.::.:||||:.|||||||..::|||....|||:|..|...|:
Human    59 LDRDKPRQ--GGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANL 121

  Fly   128 GLEISKWLELFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDG 192
            ..|.:.:..:||.:||.|..|...|..||.|:.:...|||:..||:...:|          ||.|
Human   122 CTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHIL----------NRKG 176

  Fly   193 FTSNAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPN 257
             ..|.:.|:|||||||:|:.||.:.|.|:|||||||:|:..|:.:||.|||||.|:|||:.|...
Human   177 -GGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG 240

  Fly   258 SLLRRFQDFVKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQV 300
            |.||..|:.::|:.|:|..:..|||.|.|:||.:|:||.|..|
Human   241 SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 96/227 (42%)
MOGAT2XP_011543569.1 LPLAT 41..297 CDD:302626 103/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146800
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57020
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 1 0.950 - 0 Normalized mean entropy S1346
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.