DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgat2 and Mogat1

DIOPT Version :9

Sequence 1:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_080989.2 Gene:Mogat1 / 68393 MGIID:1915643 Length:335 Species:Mus musculus


Alignment Length:341 Identity:126/341 - (36%)
Similarity:188/341 - (55%) Gaps:18/341 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIEWAPLRVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGLLVRSLMVTYLAYVFVHH 65
            |.:|:|||..||.|.||......:....|:|:.|...::...::|....   |.:.||.:.:...
Mouse     1 MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWF---LYIPYLVWFYYDW 62

  Fly    66 KKTQSVVDGNGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLE 130
            :..:.  .|..|...::..:.:::::|||:.||||.:|....|||....||||...|...|...:
Mouse    63 RTPEQ--GGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFGNFCTK 125

  Fly   131 ISKWLELFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTS 195
            .|.:.:|||.....|......|..|..||.|...|.||||||:|..:|||          || ..
Mouse   126 YSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSK----------DG-GG 179

  Fly   196 NAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLL 260
            |...|::|||:||:::|||.:.|.::.|||||:||:..|:|:||.|||||.|::.|:.||..|.|
Mouse   180 NVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWL 244

  Fly   261 RRFQDFVKKLTGVS-PLIPVGRGFFNYTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQ 324
            |..||.:....||: ||| ..||.|.:.||.:|:|:.|..|||.||.|.:..:|.||.::::|..
Mouse   245 RTIQDAMYDSMGVALPLI-YARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQT 308

  Fly   325 VIESLEKLFDQYKDKY 340
            .:|.|:|||:::|.||
Mouse   309 YLEELKKLFNEHKGKY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 107/266 (40%)
Mogat1NP_080989.2 LPLAT 41..335 CDD:418432 113/301 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836749
Domainoid 1 1.000 217 1.000 Domainoid score I2664
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3298
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8869
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.