DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgat2 and Awat1

DIOPT Version :9

Sequence 1:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001102841.1 Gene:Awat1 / 679520 RGDID:1587163 Length:328 Species:Rattus norvegicus


Alignment Length:334 Identity:114/334 - (34%)
Similarity:176/334 - (52%) Gaps:41/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FFTSMLLILLSVSFLLVAG-------SLIYGGL-LVRSLMVTYLAYVFVHHKKTQS--------V 71
            :..|:.|:...:|:|.:..       ||.:..| |:.||.|.:    |:...||.:        |
  Rat     9 YLQSLSLLQWPLSYLAIFWIVQPLFFSLFFTPLWLLPSLYVVW----FILDWKTPNQGGRRSAWV 69

  Fly    72 VDGNGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLEISKWLE 136
            .:.|.|         .|.|||||:.::||.:|..::|||:...|||:|..|...|...|.:.:.:
  Rat    70 RNWNIW---------THIRDYFPITILKTKDLSPSQNYIMGVHPHGLLTFGAFCNFCTEATGFSK 125

  Fly   137 LFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAIL 201
            .||.:.|.|.||...|.:|.:|:.:...|:.|||:.::..:||..            |.|.|.|:
  Rat   126 TFPGITPHLATLSWFFKIPLIRDYIMAKGVCSVSQASIDYLLSHG------------TGNLVGIV 178

  Fly   202 VGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRRFQDF 266
            |||..||:.|.|....|.||.||||||.|:|.|:.:||:|:|||.:::|||.....|.:.:||.|
  Rat   179 VGGVGEALQSVPNTTTLILKKRKGFVRTALRHGAHLVPTFTFGETEVYDQVVFHEESRMFKFQSF 243

  Fly   267 VKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQVIESLEK 331
            .:::.|....:..|:||.....|.||:.|.||.|||.|:.:.:.::|..|.|||.|...:::|.|
  Rat   244 FRRIFGFYFCVFYGQGFHQECKGLLPYHRPIVTVVGEPLPLPQVKNPSPEIVDKYHALYMDALYK 308

  Fly   332 LFDQYKDKY 340
            ||:|:|.:|
  Rat   309 LFEQHKVQY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 98/265 (37%)
Awat1NP_001102841.1 LPLAT 34..327 CDD:302626 110/309 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340453
Domainoid 1 1.000 212 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3307
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm9114
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X186
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.