DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and AT3G26820

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_189317.1 Gene:AT3G26820 / 822297 AraportID:AT3G26820 Length:634 Species:Arabidopsis thaliana


Alignment Length:374 Identity:74/374 - (19%)
Similarity:129/374 - (34%) Gaps:121/374 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SLLWRTIMVIYLV-----YVYANHKRTHSIMDGNGWKINRNNWLFR-----HYRDYFPVQLVKTA 101
            :|||:..|:...:     ::|:....|..:..|      |:.||..     .|....|..:|:  
plant   267 TLLWKLEMLKSAIASVNSHIYSVKAETLILPSG------RDQWLLNEEDIVRYSRTLPNCIVR-- 323

  Fly   102 ELPPNKNYILASFPHGILGTGISINMGLDISKWLQL-------------FPQVRPKVATLDQ--- 150
            :|..|..:.|             :...||::..::|             ...::|....|.|   
plant   324 KLDDNGQFPL-------------LEDSLDLATIIKLTCFYRRGKSHDYVSDYIKPTPFELQQLLD 375

  Fly   151 ------NFLTPIVRGLLRSWGLVSVSKE----------ALVYLLTKSNDPKHKDN---RDGF-TS 195
                  :.::|::...|.. ||:...:.          ..:|:.....|||..|.   ..|. .|
plant   376 EHRLLMDAISPVMLSTLED-GLLLKERNIHMRGLTHPMVFMYIQDSLVDPKMFDKYKLMGGVPVS 439

  Fly   196 NA-----------VAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDIL 249
            |.           |.:..||.:|||.....:|.|....:..||::|.:.|:.|||....||.||.
plant   440 NMNFYKLLREKAHVLLYPGGVREALHRKGEEYKLFWPEQSEFVRVASKFGAKIVPFGVVGEDDIF 504

  Fly   250 DQVANPPNSR-VRRFQDFVKRIT-----------------------GISPLIPVGRGIFNYSFGF 290
            :.|.:..:.| :...:|.:::.|                       |:.|.||   |.|.|.|  
plant   505 NIVLDSNDQRNIPILKDLMEKATKDAGNLRWKETKANWETKIAIIPGLVPKIP---GRFYYYF-- 564

  Fly   291 LPNRRRIVQVVGAPIDVV--QSDQPDAAYVDKIHKQVIDDLEKMFAKYK 337
                       |.|||:.  :.:..|.....:::.|...::|:..|..|
plant   565 -----------GKPIDLAGKEKELKDKEKAQEVYLQAKSEVEQCIAYLK 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 72/371 (19%)
AT3G26820NP_189317.1 Abhydrolase_1 88..336 CDD:278959 16/89 (18%)
Abhydrolase_5 <150..>183 CDD:289465
LPLAT_MGAT-like 397..599 CDD:153249 46/217 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.